Beta-lactamase

Details

Name
Beta-lactamase
Synonyms
  • 3.5.2.6
  • CTX-M-27
Gene Name
blaCTX-M-27
Organism
Escherichia coli
Amino acid sequence
>lcl|BSEQ0052133|Beta-lactamase
MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ
VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM
TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP
RDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGS
GGYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Number of residues
291
Molecular Weight
30921.06
Theoretical pI
Not Available
GO Classification
Functions
beta-lactamase activity
Processes
beta-lactam antibiotic catabolic process / response to antibiotic
General Function
Not Available
Specific Function
Beta-lactamase activity
Pfam Domain Function
Not Available
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ840M4
UniProtKB Entry NameQ840M4_ECOLX
General References
  1. Bonnet R, Recule C, Baraduc R, Chanal C, Sirot D, De Champs C, Sirot J: Effect of D240G substitution in a novel ESBL CTX-M-27. J Antimicrob Chemother. 2003 Jul;52(1):29-35. Epub 2003 May 29. [PubMed:12775683]
  2. Chen Y, Delmas J, Sirot J, Shoichet B, Bonnet R: Atomic resolution structures of CTX-M beta-lactamases: extended spectrum activities from increased mobility and decreased stability. J Mol Biol. 2005 Apr 29;348(2):349-62. [PubMed:15811373]
  3. Zong Z, Partridge SR, Thomas L, Iredell JR: Dominance of blaCTX-M within an Australian extended-spectrum beta-lactamase gene pool. Antimicrob Agents Chemother. 2008 Nov;52(11):4198-202. doi: 10.1128/AAC.00107-08. Epub 2008 Aug 25. [PubMed:18725449]
  4. Lee SG, Jeong SH, Lee H, Kim CK, Lee Y, Koh E, Chong Y, Lee K: Spread of CTX-M-type extended-spectrum beta-lactamases among bloodstream isolates of Escherichia coli and Klebsiella pneumoniae from a Korean hospital. Diagn Microbiol Infect Dis. 2009 Jan;63(1):76-80. doi: 10.1016/j.diagmicrobio.2008.09.002. [PubMed:19073302]
  5. Matsumura Y, Pitout JD, Gomi R, Matsuda T, Noguchi T, Yamamoto M, Peirano G, DeVinney R, Bradford PA, Motyl MR, Tanaka M, Nagao M, Takakura S, Ichiyama S: Global Escherichia coli Sequence Type 131 Clade with blaCTX-M-27 Gene. Emerg Infect Dis. 2016 Nov;22(11):1900-1907. doi: 10.3201/eid2211.160519. [PubMed:27767006]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02772Sucroseapproved, experimental, investigationalunknownDetails
DB04035Ceftazidime BATSIexperimentalunknownDetails
DB09060AvibactamapprovedyesinhibitorDetails
DB12107Vaborbactamapproved, investigationalyesinhibitorDetails
DB12377Relebactamapproved, investigationalyesinhibitorDetails
DB01598ImipenemapprovednosubstrateDetails