Hornerin

Details

Name
Hornerin
Synonyms
  • S100A18
Gene Name
HRNR
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049866|Hornerin
MPKLLQGVITVIDVFYQYATQHGEYDTLNKAELKELLENEFHQILKNPNDPDTVDIILQS
LDRDHNKKVDFTEYLLMIFKLVQARNKIIGKDYCQVSGSKLRDDTHQHQEEQEETEKEEN
KRQESSFSHSSWSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYG
EQNSDSHQSSGRGQCGSGSGQSPNYGQHGSGSGQSSSNDTHGSGSGQSSGFSQHKSSSGQ
SSGYSQHGSGSGHSSGYGQHGSRSGQSSRGERHRSSSGSSSSYGQHGSGSRQSLGHGRQG
SGSRQSPSHVRHGSGSGHSSSHGQHGSGSSYSYSRGHYESGSGQTSGFGQHESGSGQSSG
YSKHGSGSGHSSSQGQHGSTSGQASSSGQHGSSSRQSSSYGQHESASRHSSGRGQHSSGS
GQSPGHGQRGSGSGQSPSSGQHGTGFGRSSSSGPYVSGSGYSSGFGHHESSSEHSSGYTQ
HGSGSGHSSGHGQHGSRSGQSSRGERQGSSAGSSSSYGQHGSGSRQSLGHSRHGSGSGQS
PSPSRGRHESGSRQSSSYGPHGYGSGRSSSRGPYESGSGHSSGLGHQESRSGQSSGYGQH
GSSSGHSSTHGQHGSTSGQSSSCGQHGATSGQSSSHGQHGSGSSQSSRYGQQGSGSGQSP
SRGRHGSDFGHSSSYGQHGSGSGWSSSNGPHGSVSGQSSGFGHKSGSGQSSGYSQHGSGS
SHSSGYRKHGSRSGQSSRSEQHGSSSGLSSSYGQHGSGSHQSSGHGRQGSGSGHSPSRVR
HGSSSGHSSSHGQHGSGTSCSSSCGHYESGSGQASGFGQHESGSGQGYSQHGSASGHFSS
QGRHGSTSGQSSSSGQHDSSSGQSSSYGQHESASHHASGRGRHGSGSGQSPGHGQRGSGS
GQSPSYGRHGSGSGRSSSSGRHGSGSGQSSGFGHKSSSGQSSGYTQHGSGSGHSSSYEQH
GSRSGQSSRSEQHGSSSGSSSSYGQHGSGSRQSLGHGQHGSGSGQSPSPSRGRHGSGSGQ
SSSYGPYRSGSGWSSSRGPYESGSGHSSGLGHRESRSGQSSGYGQHGSSSGHSSTHGQHG
STSGQSSSCGQHGASSGQSSSHGQHGSGSSQSSGYGRQGSGSGQSPGHGQRGSGSRQSPS
YGRHGSGSGRSSSSGQHGSGLGESSGFGHHESSSGQSSSYSQHGSGSGHSSGYGQHGSRS
GQSSRGERHGSSSGSSSHYGQHGSGSRQSSGHGRQGSGSGHSPSRGRHGSGLGHSSSHGQ
HGSGSGRSSSRGPYESRSGHSSVFGQHESGSGHSSAYSQHGSGSGHFCSQGQHGSTSGQS
STFDQEGSSTGQSSSYGHRGSGSSQSSGYGRHGAGSGQSPSRGRHGSGSGHSSSYGQHGS
GSGWSSSSGRHGSGSGQSSGFGHHESSSWQSSGCTQHGSGSGHSSSYEQHGSRSGQSSRG
ERHGSSSGSSSSYGQHGSGSRQSLGHGQHGSGSGQSPSPSRGRHGSGSGQSSSYSPYGSG
SGWSSSRGPYESGSSHSSGLGHRESRSGQSSGYGQHGSSSGHSSTHGQHGSTSGQSSSCG
QHGASSGQSSSHGQHGSGSSQSSGYGRQGSGSGQSPGHGQRGSGSRQSPSYGRHGSGSGR
SSSSGQHGSGLGESSGFGHHESSSGQSSSYSQHGSGSGHSSGYGQHGSRSGQSSRGERHG
SSSRSSSRYGQHGSGSRQSSGHGRQGSGSGQSPSRGRHGSGLGHSSSHGQHGSGSGRSSS
RGPYESRSGHSSVFGQHESGSGHSSAYSQHGSGSGHFCSQGQHGSTSGQSSTFDQEGSST
GQSSSHGQHGSGSSQSSSYGQQGSGSGQSPSRGRHGSGSGHSSSYGQHGSGSGWSSSSGR
HGSGSGQSSGFGHHESSSWQSSGYTQHGSGSGHSSSYEQHGSRSGQSSRGEQHGSSSGSS
SSYGQHGSGSRQSLGHGQHGSGSGQSPSPSRGRHGSGSGQSSSYGPYGSGSGWSSSRGPY
ESGSGHSSGLGHRESRSGQSSGYGQHGSSSGHSSTHGQHGSASGQSSSCGQHGASSGQSS
SHGQHGSGSSQSSGYGRQGSGSGQSPGHGQRGSGSRQSPSYGRHGSGSGRSSSSGQHGPG
LGESSGFGHHESSSGQSSSYSQHGSGSGHSSGYGQHGSRSGQSSRGERHGSSSGSSSRYG
QHGSGSRQSSGHGRQGSGSGHSPSRGRHGSGSGHSSSHGQHGSGSGRSSSRGPYESRSGH
SSVFGQHESGSGHSSAYSQHGSGSGHFCSQGQHGSTSGQSSTFDQEGSSTGQSSSHGQHG
SGSSQSSSYGQQGSGSGQSPSRGRHGSGSGHSSSYGQHGSGSGWSSSSGRHGSGSGQSSG
FGHHESSSWQSSGYTQHGSGSGHSSSYEQHGSRSGQSSRGERHGSSSGSSSSYGQHGSGS
RQSLGHGQHGSGSGQSPSPSRGRHGSGSGQSSSYSPYGSGSGWSSSRGPYESGSGHSSGL
GHRESRSGQSSGYGQHGSSSGHSSTHGQHGSTSGQSSSCGQHGASSGQSSSHGQHGSGSS
QSSGYGRQGSGSGQSPGHGQRGSGSRQSPSYGRHGSGSGRSSSSGQHGSGLGESSGFGHH
ESSSGQSSSYSQHGSGSGHSSGYGQHGSRSGQSSRGERHGSSSGSSSHYGQHGSGSRQSS
GHGRQGSGSGQSPSRGRHGSGLGHSSSHGQHGSGSGRSSSRGPYESRLGHSSVFGQHESG
SGHSSAYSQHGSGSGHFCSQGQHGSTSGQSSTFDQEGSSTGQSSSYGHRGSGSSQSSGYG
RHGAGSGQSLSHGRHGSGSGQSSSYGQHGSGSGQSSGYSQHGSGSGQDGYSYCKGGSNHD
GGSSGSYFLSFPSSTSPYEYVQEQRCYFYQ
Number of residues
2850
Molecular Weight
282390.185
Theoretical pI
Not Available
GO Classification
Functions
calcium ion binding / transition metal ion binding
Processes
cell envelope organization / establishment of skin barrier / keratinization / neutrophil degranulation
Components
azurophil granule lumen / cornified envelope / cytoplasm / extracellular exosome / extracellular region / keratohyalin granule / nucleus / perinuclear region of cytoplasm
General Function
Component of the epidermal cornified cell envelopes.
Specific Function
Calcium ion binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic granule
Gene sequence
>lcl|BSEQ0049867|Hornerin (HRNR)
ATGCCTAAACTCCTACAAGGCGTCATCACTGTCATCGATGTTTTCTACCAATATGCCACC
CAGCATGGGGAGTATGATACGTTGAACAAGGCAGAGCTGAAAGAACTTCTGGAAAATGAG
TTTCATCAAATTCTGAAGAATCCAAACGATCCAGATACTGTGGATATCATCTTGCAAAGT
CTGGATCGAGACCATAACAAGAAAGTGGATTTTACTGAGTATCTTCTGATGATATTCAAG
CTGGTTCAGGCTCGTAATAAAATCATTGGCAAAGATTACTGCCAAGTTTCAGGGTCAAAG
CTGAGAGATGACACTCACCAGCACCAAGAGGAACAAGAAGAAACTGAAAAAGAGGAGAAC
AAACGGCAAGAATCCTCTTTTAGTCATTCAAGTTGGAGTGCAGGAGAGAATGATTCCTAT
TCCAGAAACGTCAGAGGAAGTCTTAAACCTGGGACTGAATCCATATCCAGAAGACTGAGT
TTTCAAAGAGACTTTTCTGGCCAACATAACTCCTACTCAGGTCAGTCTTCCAGCTATGGT
GAGCAAAACTCCGACTCCCATCAGTCTTCAGGCCGCGGCCAATGTGGGTCTGGGTCAGGG
CAGTCTCCCAACTATGGCCAACACGGCTCTGGCTCCGGACAGTCTTCCAGCAATGACACA
CATGGGTCTGGCTCAGGCCAGTCTTCTGGCTTTAGTCAACACAAGTCTAGCTCAGGGCAG
TCCTCTGGTTACAGTCAGCATGGATCTGGCTCAGGTCACTCCTCTGGCTACGGACAACAC
GGCTCTAGGTCAGGACAGTCATCTAGGGGTGAACGACACAGATCTAGCTCAGGTTCGTCT
TCCAGCTATGGTCAGCATGGGTCTGGTTCCCGTCAGTCTTTGGGCCACGGCCGACAAGGG
TCTGGATCTCGCCAGTCTCCTAGCCACGTCCGACATGGGTCCGGTTCGGGGCACTCCTCC
AGCCACGGCCAACACGGGTCTGGCTCAAGTTACTCTTACAGCCGTGGCCATTATGAGTCT
GGCTCAGGCCAGACTTCTGGCTTTGGGCAACATGAGTCTGGCTCAGGACAGTCCTCTGGC
TATAGTAAGCATGGTTCTGGCTCAGGTCACTCCTCTAGCCAGGGACAACATGGATCTACG
TCAGGGCAGGCATCAAGCTCTGGCCAACATGGCTCCAGCTCACGTCAGTCTTCCAGCTAT
GGTCAGCATGAGTCTGCCTCCCGTCACTCTTCAGGCCGCGGCCAACACAGCTCTGGATCT
GGCCAGTCTCCAGGCCACGGCCAGCGTGGGTCTGGGTCAGGGCAGTCTCCCAGCTCCGGC
CAACATGGGACTGGCTTTGGTCGATCTTCCAGCAGTGGCCCATATGTGTCTGGTTCAGGC
TACTCTTCTGGCTTTGGTCACCACGAGTCTAGCTCAGAGCATTCCTCTGGTTACACTCAG
CATGGATCTGGCTCAGGTCACTCCTCCGGCCACGGACAACACGGCTCTAGGTCAGGACAG
TCATCTAGGGGTGAACGACAAGGATCTAGTGCAGGTTCATCTTCCAGCTATGGTCAGCAT
GGGTCTGGCTCCCGTCAATCTTTGGGACACAGCCGACATGGGTCTGGATCTGGCCAGTCT
CCTAGCCCTAGCCGTGGCCGACATGAGTCTGGTTCCAGGCAGTCTTCCAGCTATGGCCCA
CATGGGTATGGCTCAGGGAGGTCTTCAAGCCGTGGCCCATATGAGTCTGGCTCCGGTCAC
TCTTCTGGCTTAGGTCACCAAGAGTCTCGCTCAGGACAGTCCTCTGGCTACGGTCAACAC
GGATCTAGCTCGGGTCATTCCTCTACCCATGGGCAACATGGTTCTACATCAGGACAGTCA
TCGAGCTGTGGCCAACATGGAGCTACCTCAGGTCAGTCTTCCAGCCACGGTCAGCATGGC
TCTGGCTCAAGTCAGTCTTCTCGCTATGGCCAACAGGGCTCTGGATCTGGCCAGTCTCCT
AGTCGCGGCCGACATGGGTCCGATTTTGGGCACTCTTCCAGCTACGGCCAACATGGGTCT
GGCTCCGGTTGGTCTTCAAGCAATGGCCCACATGGGTCTGTCTCAGGCCAGTCTTCCGGC
TTTGGTCACAAGTCTGGCTCAGGGCAGTCCTCTGGTTACAGTCAGCATGGATCTGGCTCA
AGTCACTCCTCCGGCTACAGAAAACACGGCTCTAGGTCAGGACAGTCATCTAGGAGTGAA
CAACACGGATCTAGCTCAGGTTTGTCTTCCAGCTATGGTCAGCATGGGTCGGGCTCCCAT
CAATCTTCGGGCCACGGCCGACAAGGGTCTGGATCTGGCCACTCTCCTAGCCGTGTCCGA
CATGGGTCCAGTTCAGGGCACTCCTCCAGCCACGGCCAACACGGGTCTGGCACAAGTTGT
TCTTCCAGCTGTGGCCATTATGAGTCTGGCTCAGGCCAGGCTTCTGGTTTTGGGCAACAC
GAGTCTGGCTCAGGACAGGGCTATAGTCAGCATGGTTCTGCCTCAGGTCACTTCTCTAGC
CAGGGACGACATGGATCTACGTCAGGGCAGTCATCAAGCTCCGGCCAACATGACTCTAGC
TCAGGTCAATCTTCCAGCTATGGTCAGCATGAGTCTGCCTCCCATCACGCTTCGGGCCGC
GGCCGACATGGCTCTGGATCTGGCCAGTCTCCAGGCCACGGCCAGCGTGGGTCTGGGTCA
GGGCAGTCTCCCAGCTATGGCCGACATGGGTCTGGCTCCGGTCGGTCTTCCAGCAGTGGC
CGACATGGGTCTGGCTCAGGCCAGTCTTCTGGCTTTGGTCACAAGTCTAGCTCAGGGCAG
TCCTCTGGTTACACTCAGCATGGATCTGGCTCAGGTCACTCCTCCAGCTACGAACAACAC
GGCTCTAGGTCAGGACAGTCATCTAGGAGCGAACAACATGGATCTAGCTCAGGTTCGTCT
TCCAGCTATGGTCAGCATGGGTCTGGCTCCCGTCAGTCTTTGGGCCACGGCCAACATGGG
TCTGGATCTGGCCAGTCTCCTAGCCCTAGCCGTGGCCGACATGGGTCTGGTTCCGGGCAG
TCTTCCAGCTATGGCCCATATAGGTCTGGCTCAGGGTGGTCTTCAAGCCGTGGCCCATAT
GAGTCTGGCTCCGGTCACTCTTCTGGCTTAGGTCACCGAGAGTCTCGCTCAGGACAGTCC
TCTGGCTACGGTCAACATGGATCTAGCTCAGGTCATTCCTCTACCCATGGGCAACACGGT
TCTACATCAGGACAGTCATCGAGCTGTGGCCAACATGGAGCTAGCTCAGGTCAGTCTTCC
AGCCACGGTCAGCATGGCTCTGGCTCAAGTCAGTCTTCTGGCTATGGCCGACAGGGCTCT
GGATCTGGCCAGTCTCCAGGCCACGGCCAGCGTGGGTCTGGGTCAAGGCAGTCTCCCAGC
TACGGCCGACATGGGTCTGGCTCCGGTCGGTCTTCCAGCAGTGGCCAACATGGGTCTGGC
TTAGGCGAGTCTTCTGGCTTTGGTCACCACGAGTCTAGCTCAGGGCAGTCCTCTAGTTAC
AGTCAGCATGGGTCTGGCTCAGGTCACTCCTCTGGCTACGGACAACACGGCTCTAGATCA
GGACAGTCATCTAGGGGTGAACGACACGGATCTAGCTCAGGTTCGTCTTCCCACTATGGT
CAGCATGGGTCTGGCTCCCGTCAGTCTTCGGGCCACGGCCGACAAGGGTCTGGATCTGGC
CATTCCCCTAGCCGCGGCCGACATGGGTCCGGTTTGGGGCACTCCTCCAGCCACGGCCAA
CATGGGTCTGGCTCAGGTCGTTCTTCCAGCCGTGGCCCATATGAGTCTCGCTCGGGTCAC
TCTTCTGTCTTTGGTCAACATGAGTCTGGCTCAGGACATTCCTCTGCTTACAGTCAGCAT
GGTAGTGGCTCAGGGCACTTCTGTAGCCAAGGACAGCATGGTTCTACATCAGGACAGTCA
TCAACCTTTGACCAGGAGGGATCTAGCACAGGCCAGTCTTCCAGCTATGGCCACCGTGGC
TCTGGCTCCAGTCAGTCTTCTGGCTATGGCCGACATGGGGCTGGATCTGGCCAGTCTCCT
AGTCGCGGCCGACATGGGTCCGGTTCTGGGCACTCTTCCAGCTACGGCCAACATGGGTCT
GGCTCCGGTTGGTCTTCCAGCAGTGGCCGACATGGGTCTGGCTCAGGTCAGTCTTCTGGA
TTTGGTCACCACGAGTCTAGCTCATGGCAGTCCTCTGGTTGCACTCAGCATGGATCTGGC
TCAGGTCACTCCTCCAGCTACGAACAACACGGCTCTAGGTCAGGACAGTCATCTAGGGGT
GAACGACACGGATCTAGCTCAGGTTCATCTTCCAGCTATGGTCAGCATGGGTCTGGCTCC
CGTCAGTCTTTGGGCCACGGCCAACATGGGTCTGGATCTGGCCAGTCTCCTAGCCCTAGC
CGTGGCCGACATGGGTCTGGTTCTGGGCAGTCTTCCAGCTACAGCCCATATGGGTCTGGC
TCAGGGTGGTCTTCCAGCCGTGGCCCATATGAGTCTGGCTCCAGTCACTCTTCTGGCTTA
GGTCACCGAGAGTCTCGCTCAGGACAGTCCTCTGGCTACGGTCAACATGGATCTAGCTCA
GGTCATTCCTCTACCCATGGGCAACATGGTTCTACATCAGGACAGTCATCGAGCTGTGGC
CAACATGGAGCTAGCTCAGGTCAGTCTTCCAGCCACGGTCAGCATGGCTCTGGCTCAAGT
CAGTCTTCTGGCTATGGCCGACAGGGCTCTGGATCTGGCCAGTCTCCAGGCCACGGCCAG
CGTGGGTCTGGGTCAAGGCAGTCTCCCAGCTACGGCCGACATGGGTCTGGCTCCGGTCGG
TCTTCCAGCAGTGGCCAACATGGGTCTGGCTTAGGCGAGTCTTCTGGCTTTGGTCACCAC
GAGTCTAGCTCAGGGCAGTCCTCTAGTTACAGTCAGCATGGGTCTGGCTCAGGTCACTCC
TCTGGCTACGGACAACACGGCTCTAGATCAGGACAGTCATCTAGGGGTGAACGACACGGA
TCTAGCTCACGTTCGTCTTCCCGCTATGGTCAGCATGGGTCTGGCTCCCGTCAGTCTTCG
GGCCACGGCCGACAAGGGTCTGGATCTGGCCAGTCCCCTAGCCGCGGCCGACATGGGTCC
GGTTTGGGGCACTCCTCCAGCCACGGCCAACATGGGTCTGGCTCAGGTCGTTCTTCCAGC
CGTGGCCCATATGAGTCTCGCTCGGGTCACTCTTCTGTCTTTGGTCAACATGAGTCTGGC
TCAGGACATTCCTCTGCTTACAGTCAGCATGGTAGTGGCTCAGGGCACTTCTGTAGCCAA
GGACAGCATGGTTCTACATCAGGACAGTCATCAACCTTTGACCAGGAGGGATCTAGCACA
GGTCAGTCTTCCAGCCACGGTCAGCATGGCTCTGGCTCAAGTCAGTCTTCTAGCTATGGC
CAACAGGGCTCTGGATCTGGCCAGTCTCCTAGTCGCGGCCGACATGGGTCCGGTTCCGGG
CACTCTTCCAGCTACGGCCAACATGGGTCTGGCTCCGGTTGGTCTTCCAGCAGTGGCCGA
CATGGGTCTGGCTCAGGTCAGTCTTCTGGATTTGGTCACCATGAGTCTAGCTCATGGCAG
TCCTCTGGTTACACTCAGCATGGATCTGGCTCAGGTCACTCCTCCAGCTACGAACAACAC
GGCTCTAGGTCAGGACAGTCATCTAGGGGTGAACAACACGGATCTAGCTCAGGTTCATCT
TCCAGCTATGGTCAGCATGGGTCTGGCTCCCGTCAGTCTTTGGGCCACGGCCAACATGGG
TCTGGATCTGGCCAGTCTCCTAGCCCTAGCCGTGGCCGACATGGGTCTGGTTCTGGGCAG
TCTTCCAGCTACGGCCCATATGGGTCTGGCTCAGGGTGGTCTTCCAGCCGTGGCCCATAT
GAGTCTGGCTCCGGTCACTCTTCTGGCTTAGGTCACCGAGAGTCTCGCTCAGGACAGTCC
TCTGGCTACGGTCAACATGGATCTAGCTCAGGTCATTCCTCTACCCATGGGCAACATGGT
TCTGCATCAGGACAGTCATCGAGCTGTGGCCAACATGGAGCTAGCTCAGGTCAGTCTTCC
AGCCACGGTCAGCATGGCTCTGGCTCAAGTCAGTCTTCTGGCTATGGCCGACAGGGCTCT
GGATCTGGCCAGTCTCCAGGCCACGGCCAGCGTGGGTCTGGGTCAAGGCAGTCTCCCAGC
TATGGCCGACATGGGTCTGGCTCCGGTCGGTCTTCCAGCAGTGGCCAACATGGGCCTGGC
TTAGGCGAGTCTTCTGGCTTTGGTCACCACGAGTCTAGCTCAGGGCAGTCCTCTAGTTAC
AGTCAGCATGGGTCTGGCTCAGGTCACTCCTCTGGCTACGGACAACACGGCTCTAGATCA
GGACAGTCATCTAGGGGTGAACGACACGGATCTAGCTCAGGTTCGTCTTCCCGCTATGGT
CAGCATGGGTCTGGCTCCCGTCAGTCTTCGGGCCACGGCCGACAAGGGTCTGGATCTGGC
CATTCCCCTAGCCGCGGCCGACATGGGTCCGGTTCGGGGCACTCCTCCAGCCACGGCCAA
CATGGGTCTGGCTCAGGTCGTTCTTCCAGCCGTGGCCCATATGAGTCTCGCTCGGGTCAC
TCTTCTGTCTTTGGTCAACATGAGTCTGGCTCAGGACATTCCTCTGCTTACAGTCAGCAT
GGTAGTGGCTCAGGGCACTTCTGTAGCCAAGGACAGCATGGTTCTACATCAGGACAGTCA
TCAACCTTTGACCAGGAGGGATCTAGCACAGGTCAGTCTTCCAGCCACGGTCAGCATGGC
TCTGGCTCAAGTCAGTCTTCTAGCTATGGCCAACAGGGCTCTGGATCTGGCCAGTCTCCT
AGTCGCGGCCGACATGGGTCCGGTTCCGGGCACTCTTCCAGCTACGGCCAACATGGGTCT
GGCTCCGGTTGGTCTTCCAGCAGTGGCCGACATGGGTCTGGCTCAGGTCAGTCTTCTGGA
TTTGGTCACCACGAGTCTAGCTCATGGCAGTCCTCTGGTTACACTCAGCATGGATCTGGC
TCAGGTCACTCCTCCAGCTACGAACAACACGGCTCTAGGTCAGGACAGTCATCTAGGGGT
GAACGACACGGATCTAGCTCAGGTTCATCTTCCAGCTATGGTCAGCATGGGTCTGGCTCC
CGTCAGTCTTTGGGCCACGGCCAACATGGGTCTGGATCTGGCCAGTCTCCTAGCCCTAGC
CGTGGCCGACATGGGTCTGGTTCTGGGCAGTCTTCCAGCTACAGCCCATATGGGTCTGGC
TCAGGGTGGTCTTCCAGCCGTGGCCCATATGAGTCTGGCTCCGGTCACTCTTCTGGCTTA
GGTCACCGAGAGTCTCGCTCAGGACAGTCCTCTGGCTACGGTCAACATGGATCTAGCTCA
GGTCATTCCTCTACCCATGGGCAACATGGTTCTACATCAGGACAGTCATCGAGCTGTGGC
CAACATGGAGCTAGCTCAGGTCAGTCTTCCAGCCACGGTCAGCATGGCTCTGGCTCAAGT
CAGTCTTCTGGCTATGGCCGACAGGGCTCTGGATCTGGCCAGTCTCCAGGCCACGGCCAG
CGTGGGTCTGGGTCAAGGCAGTCTCCCAGCTACGGCCGACATGGGTCTGGCTCCGGTCGG
TCTTCCAGCAGTGGCCAACATGGGTCTGGCTTAGGCGAGTCTTCTGGCTTTGGTCACCAC
GAGTCTAGCTCAGGGCAGTCCTCTAGTTACAGTCAGCATGGGTCTGGCTCAGGTCACTCC
TCTGGCTACGGACAACACGGCTCTAGATCAGGACAGTCATCTAGGGGTGAACGACACGGA
TCTAGCTCAGGTTCGTCTTCCCACTATGGTCAGCATGGGTCTGGCTCCCGTCAGTCTTCG
GGCCACGGCCGACAAGGGTCTGGATCTGGCCAGTCCCCTAGCCGCGGCCGACATGGGTCC
GGTTTGGGGCACTCCTCCAGCCACGGCCAACATGGGTCTGGCTCAGGTCGTTCTTCCAGC
CGTGGCCCATATGAGTCTCGCTTGGGTCACTCTTCTGTCTTTGGTCAACATGAGTCTGGC
TCAGGACATTCCTCTGCTTACAGTCAGCATGGTAGTGGCTCAGGGCACTTCTGTAGCCAA
GGACAGCATGGTTCTACATCAGGACAGTCATCAACCTTTGACCAGGAGGGATCTAGCACA
GGCCAGTCTTCCAGCTATGGCCACCGTGGCTCTGGCTCCAGTCAGTCTTCTGGCTATGGC
CGACATGGGGCTGGATCTGGCCAGTCTCTTAGCCACGGCCGACACGGGTCTGGTTCAGGG
CAGTCTTCCAGCTACGGCCAACATGGGTCTGGCTCAGGACAGTCCTCTGGTTATAGTCAG
CATGGAAGTGGCTCAGGGCAAGATGGGTATTCTTATTGCAAAGGAGGAAGTAACCATGAT
GGGGGAAGTTCTGGCTCATATTTTCTCAGTTTTCCTAGTAGCACTTCACCCTATGAATAT
GTCCAAGAGCAGAGGTGCTACTTTTATCAGTGA
Chromosome Location
1
Locus
1q21.3
External Identifiers
ResourceLink
UniProtKB IDQ86YZ3
UniProtKB Entry NameHORN_HUMAN
HGNC IDHGNC:20846
General References
  1. Takaishi M, Makino T, Morohashi M, Huh NH: Identification of human hornerin and its expression in regenerating and psoriatic skin. J Biol Chem. 2005 Feb 11;280(6):4696-703. Epub 2004 Oct 26. [PubMed:15507446]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332]
  5. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  6. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  7. Henry J, Hsu CY, Haftek M, Nachat R, de Koning HD, Gardinal-Galera I, Hitomi K, Balica S, Jean-Decoster C, Schmitt AM, Paul C, Serre G, Simon M: Hornerin is a component of the epidermal cornified cell envelopes. FASEB J. 2011 May;25(5):1567-76. doi: 10.1096/fj.10-168658. Epub 2011 Jan 31. [PubMed:21282207]
  8. Makino T, Yamakoshi T, Mizawa M, Shimizu T: Ultraviolet B irradiation induces the expression of hornerin in xenotransplanted human skin. Acta Histochem. 2014 Jan;116(1):20-4. doi: 10.1016/j.acthis.2013.05.001. Epub 2013 Jun 14. [PubMed:23751202]
  9. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails