Serine/threonine-protein kinase haspin

Details

Name
Serine/threonine-protein kinase haspin
Synonyms
  • 2.7.11.1
  • Germ cell-specific gene 2 protein
  • H-haspin
  • Haploid germ cell-specific nuclear protein kinase
Gene Name
GSG2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037262|Serine/threonine-protein kinase haspin
MAASLPGPGSRLFRTYGAADGRRQRRPGREAAQWFPPQDRRRFFNSSGSSDASIGDPSQS
DDPDDPDDPDFPGSPVRRRRRRPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRA
RPPQKCSTPCGPLRLPPFPSRDSGRLSPDLSVCGQPRDGDELGISASLFSSLASPCPGSP
TPRDSVISIGTSACLVAASAVPSGLHLPEVSLDRASLPCSQEEATGGAKDTRMVHQTRAS
LRSVLFGLMNSGTPEDSEFRADGKNMRESCCKRKLVVGNGPEGPGLSSTGKRRATGQDSC
QERGLQEAVRREHQEASVPKGRIVPRGIDRLERTRSSRKSKHQEATETSLLHSHRFKKGQ
KLGKDSFPTQDLTPLQNVCFWTKTRASFSFHKKKIVTDVSEVCSIYTTATSLSGSLLSEC
SNRPVMNRTSGAPSSWHSSSMYLLSPLNTLSISNKKASDAEKVYGECSQKGPVPFSHCLP
TEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISK
ELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLF
IVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKT
SLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFD
IYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRT
MLNFSSATDLLCQHSLFK
Number of residues
798
Molecular Weight
88494.565
Theoretical pI
9.37
GO Classification
Functions
ATP binding / histone kinase activity (H3-T3 specific) / protein kinase activity
Processes
histone H3-T3 phosphorylation involved in chromosome passenger complex localization to kinetochore / intracellular signal transduction / mitotic sister chromatid cohesion / protein localization to chromosome, centromeric region / protein phosphorylation / regulation of spindle checkpoint
Components
centrosome / chromosome / cytoplasm / nucleus / spindle
General Function
Protein kinase activity
Specific Function
Serine/threonine-protein kinase that phosphorylates histone H3 at 'Ser-3' (H3T3ph) during mitosis. This positions and activates AURKB and other components of the chromosomal passenger complex (CPC) at centromeres to ensure proper chromatid cohesion, metaphase alignment and normal progression through the cell cycle.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Nucleus
Gene sequence
>lcl|BSEQ0017229|Serine/threonine-protein kinase haspin (GSG2)
ATGGCGGCTTCGCTCCCGGGACCTGGGAGCCGGCTTTTCCGCACATATGGGGCTGCGGAC
GGCAGGAGACAGCGGCGGCCGGGCCGGGAAGCCGCGCAGTGGTTCCCGCCGCAGGACCGG
AGGCGTTTCTTCAACAGCAGCGGCAGCAGCGACGCCAGCATCGGCGACCCCTCGCAGTCC
GACGATCCTGACGATCCCGACGACCCCGACTTCCCCGGCAGCCCGGTGAGGCGGCGGCGG
AGGCGTCCCGGCGGCCGAGTGCCCAAGGACCGGCCCAGCCTGACCGTGACCCCAAAGCGC
TGGAAGCTGCGAGCTCGCCCAAGCCTAACCGTGACCCCAAGACGCCTGGGGCTGCGAGCT
CGGCCCCCGCAGAAGTGCAGCACACCCTGCGGCCCGCTCCGACTTCCGCCCTTCCCCAGC
CGCGACTCCGGCCGCCTCAGCCCGGACCTCAGCGTGTGCGGCCAGCCCAGGGACGGCGAC
GAGCTGGGCATCAGTGCCTCCCTGTTCAGCTCTCTGGCCTCGCCCTGCCCCGGGTCCCCA
ACGCCAAGGGACAGTGTCATCTCGATCGGCACCTCCGCCTGTCTGGTTGCAGCCTCAGCC
GTCCCGAGCGGCCTCCACCTCCCAGAAGTCTCCCTGGACCGAGCATCTCTCCCCTGCTCC
CAGGAGGAAGCGACAGGAGGAGCCAAGGACACCAGGATGGTCCACCAAACCCGCGCCAGC
CTCAGGTCAGTTCTCTTTGGCCTTATGAACTCAGGAACCCCTGAGGATTCTGAGTTTCGG
GCAGATGGGAAGAATATGAGAGAGTCCTGCTGTAAAAGGAAACTGGTGGTGGGAAATGGA
CCAGAGGGTCCAGGTCTGTCAAGCACAGGCAAGAGGAGGGCCACAGGCCAGGACTCTTGT
CAAGAGAGAGGGCTTCAAGAGGCCGTCCGGAGAGAGCATCAGGAGGCCAGTGTTCCCAAG
GGCCGCATTGTGCCAAGGGGAATAGACAGGCTGGAGAGAACTAGATCAAGCCGGAAGAGC
AAACATCAGGAGGCAACGGAAACCTCTCTCCTCCATTCCCACCGCTTTAAAAAGGGCCAA
AAGCTGGGAAAAGATTCGTTCCCCACCCAGGACCTGACTCCTTTACAGAATGTCTGCTTT
TGGACCAAAACCAGGGCTTCCTTCAGTTTCCACAAGAAGAAAATTGTGACTGATGTGTCA
GAGGTCTGCAGCATCTATACCACTGCCACTTCTCTCTCTGGATCCCTCCTATCAGAATGT
TCAAACCGGCCTGTCATGAACAGAACAAGTGGTGCTCCGTCCTCTTGGCACTCCTCCTCT
ATGTATTTGCTAAGCCCCTTAAACACTCTAAGTATTTCAAACAAAAAGGCATCTGATGCT
GAAAAGGTTTATGGGGAATGCAGTCAGAAGGGTCCTGTCCCCTTTAGCCATTGCCTTCCC
ACAGAAAAACTGCAACGCTGTGAGAAGATTGGGGAAGGGGTGTTTGGCGAAGTGTTTCAA
ACAATTGCTGATCACACACCCGTAGCCATAAAAATCATTGCTATTGAAGGACCAGATTTA
GTCAATGGATCCCATCAGAAAACCTTTGAGGAAATCCTGCCAGAGATCATCATCTCCAAA
GAGTTGAGCCTCTTATCCGGTGAAGTGTGCAACCGCACAGAAGGCTTTATCGGGCTGAAC
TCAGTGCACTGTGTCCAGGGATCTTACCCTCCCTTGCTCCTCAAAGCCTGGGATCACTAT
AATTCAACCAAAGGCTCTGCAAATGACCGGCCTGATTTTTTTAAAGACGACCAGCTCTTC
ATTGTGCTGGAATTTGAGTTTGGAGGGATTGACTTAGAGCAAATGCGAACCAAGTTGTCT
TCCTTGGCTACTGCAAAGAGCATTCTACACCAGCTCACAGCCTCCCTCGCAGTGGCAGAG
GCATCACTGCGCTTTGAGCACCGAGACTTACACTGGGGGAACGTGCTCTTAAAGAAAACC
AGCCTCAAAAAACTCCACTACACCCTCAATGGGAAGAGCAGCACTATCCCCAGCTGTGGG
TTGCAAGTGAGCATCATTGACTACACCCTGTCGCGCTTGGAACGGGATGGGATTGTGGTT
TTCTGTGACGTTTCCATGGATGAGGACCTGTTTACCGGTGACGGTGACTACCAGTTTGAC
ATCTACAGGCTCATGAAGAAGGAGAATAACAACCGCTGGGGTGAATATCACCCTTATAGT
AATGTGCTCTGGTTACATTACCTGACAGACAAGATGCTGAAACAAATGACCTTCAAGACT
AAATGTAACACTCCTGCCATGAAGCAAATTAAGAGAAAAATCCAGGAGTTCCACAGGACA
ATGCTGAACTTCAGCTCTGCCACTGACTTGCTCTGCCAGCACAGTCTGTTTAAGTAA
Chromosome Location
17
Locus
17p13
External Identifiers
ResourceLink
UniProtKB IDQ8TF76
UniProtKB Entry NameHASP_HUMAN
GenBank Protein ID118421077
GenBank Gene IDAB039834
HGNC IDHGNC:19682
General References
  1. Tanaka H, Iguchi N, Nakamura Y, Kohroki J, de Carvalho CE, Nishimune Y: Cloning and characterization of human haspin gene encoding haploid germ cell-specific nuclear protein kinase. Mol Hum Reprod. 2001 Mar;7(3):211-8. [PubMed:11228240]
  2. Higgins JM: The Haspin gene: location in an intron of the integrin alphaE gene, associated transcription of an integrin alphaE-derived RNA and expression in diploid as well as haploid cells. Gene. 2001 Apr 4;267(1):55-69. [PubMed:11311556]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Dai J, Sultan S, Taylor SS, Higgins JM: The kinase haspin is required for mitotic histone H3 Thr 3 phosphorylation and normal metaphase chromosome alignment. Genes Dev. 2005 Feb 15;19(4):472-88. Epub 2005 Jan 28. [PubMed:15681610]
  7. Dai J, Sullivan BA, Higgins JM: Regulation of mitotic chromosome cohesion by Haspin and Aurora B. Dev Cell. 2006 Nov;11(5):741-50. [PubMed:17084365]
  8. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  9. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332]
  10. Wang F, Dai J, Daum JR, Niedzialkowska E, Banerjee B, Stukenberg PT, Gorbsky GJ, Higgins JM: Histone H3 Thr-3 phosphorylation by Haspin positions Aurora B at centromeres in mitosis. Science. 2010 Oct 8;330(6001):231-5. doi: 10.1126/science.1189435. Epub 2010 Aug 12. [PubMed:20705812]
  11. Yamagishi Y, Honda T, Tanno Y, Watanabe Y: Two histone marks establish the inner centromere and chromosome bi-orientation. Science. 2010 Oct 8;330(6001):239-43. doi: 10.1126/science.1194498. [PubMed:20929775]
  12. Wang F, Ulyanova NP, van der Waal MS, Patnaik D, Lens SM, Higgins JM: A positive feedback loop involving Haspin and Aurora B promotes CPC accumulation at centromeres in mitosis. Curr Biol. 2011 Jun 21;21(12):1061-9. doi: 10.1016/j.cub.2011.05.016. Epub 2011 Jun 9. [PubMed:21658950]
  13. Huertas D, Soler M, Moreto J, Villanueva A, Martinez A, Vidal A, Charlton M, Moffat D, Patel S, McDermott J, Owen J, Brotherton D, Krige D, Cuthill S, Esteller M: Antitumor activity of a small-molecule inhibitor of the histone kinase Haspin. Oncogene. 2012 Mar 15;31(11):1408-18. doi: 10.1038/onc.2011.335. Epub 2011 Aug 1. [PubMed:21804608]
  14. Eswaran J, Patnaik D, Filippakopoulos P, Wang F, Stein RL, Murray JW, Higgins JM, Knapp S: Structure and functional characterization of the atypical human kinase haspin. Proc Natl Acad Sci U S A. 2009 Dec 1;106(48):20198-203. doi: 10.1073/pnas.0901989106. Epub 2009 Nov 16. [PubMed:19918057]
  15. Villa F, Capasso P, Tortorici M, Forneris F, de Marco A, Mattevi A, Musacchio A: Crystal structure of the catalytic domain of Haspin, an atypical kinase implicated in chromatin organization. Proc Natl Acad Sci U S A. 2009 Dec 1;106(48):20204-9. doi: 10.1073/pnas.0908485106. Epub 2009 Nov 16. [PubMed:19918049]
  16. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB046045-iodotubercidinexperimentalunknownDetails
DB076983-(3-aminophenyl)-N-(3-chlorophenyl)pyrazolo[1,5-a]pyrimidin-5-amineexperimentalunknownDetails
DB07995H-89experimentalunknownDetails
DB08004(2S)-2-{[3-(3-aminophenyl)imidazo[1,2-b]pyridazin-6-yl]amino}-3-methylbutan-1-olexperimentalunknownDetails