Unsaturated glucuronyl hydrolase

Details

Name
Unsaturated glucuronyl hydrolase
Synonyms
  • 3.2.1.179
  • Glycosaminoglycan hydrolase
  • Glycuronidase
  • UGL
  • Unsaturated uronic acid hydrolase
Gene Name
ugl
Organism
Bacillus sp. (strain GL1)
Amino acid sequence
>lcl|BSEQ0012214|Unsaturated glucuronyl hydrolase
MWQQAIGDALGITARNLKKFGDRFPHVSDGSNKYVLNDNTDWTDGFWSGILWLCYEYTGD
EQYREGAVRTVASFRERLDRFENLDHHDIGFLYSLSAKAQWIVEKDESARKLALDAADVL
MRRWRADAGIIQAWGPKGDPENGGRIIIDCLLNLPLLLWAGEQTGDPEYRRVAEAHALKS
RRFLVRGDDSSYHTFYFDPENGNAIRGGTHQGNTDGSTWTRGQAWGIYGFALNSRYLGNA
DLLETAKRMARHFLARVPEDGVVYWDFEVPQEPSSYRDSSASAITACGLLEIASQLDESD
PERQRFIDAAKTTVTALRDGYAERDDGEAEGFIRRGSYHVRGGISPDDYTIWGDYYYLEA
LLRLERGVTGYWYERGR
Number of residues
377
Molecular Weight
42861.02
Theoretical pI
4.93
GO Classification
Functions
hydrolase activity, acting on glycosyl bonds
Processes
polysaccharide catabolic process
Components
cytoplasm
General Function
Hydrolase activity, acting on glycosyl bonds
Specific Function
Catalyzes the hydrolysis of oligosaccharides with unsaturated glucuronyl residues at the non-reducing terminal, to a sugar or an amino sugar, and an unsaturated D-glucuronic acid (GlcA), which is nonenzymatically converted immediately to alpha-keto acid.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0006173|1134 bp
ATGTGGCAGCAAGCGATAGGCGACGCGCTCGGCATTACCGCCCGCAATCTCAAGAAATTC
GGGGACCGTTTCCCCCATGTCAGCGACGGGAGCAACAAGTACGTGCTGAACGACAATACC
GACTGGACAGACGGTTTCTGGTCCGGCATCCTGTGGCTCTGCTACGAATATACGGGAGAC
GAGCAATACCGCGAGGGCGCCGTCCGGACGGTCGCGAGCTTCCGCGAACGTCTGGATCGT
TTCGAGAATCTCGATCATCACGACATCGGCTTCCTATACTCGCTGTCGGCCAAGGCCCAA
TGGATCGTCGAAAAGGACGAATCCGCGCGCAAGCTGGCGCTCGATGCCGCCGACGTGCTG
ATGCGCCGCTGGCGCGCGGATGCGGGCATTATCCAGGCCTGGGGACCGAAGGGCGATCCG
GAAAACGGCGGACGCATCATCATCGACTGCCTGCTGAATCTGCCGCTTTTGCTCTGGGCC
GGCGAACAGACGGGCGATCCCGAATACCGCCGCGTCGCCGAGGCGCACGCGCTGAAAAGC
CGCCGGTTCCTCGTGCGCGGCGACGATTCGAGCTATCATACGTTCTACTTCGACCCAGAA
AACGGGAATGCCATCCGCGGCGGCACGCACCAGGGCAACACCGACGGCAGCACGTGGACG
CGCGGCCAGGCTTGGGGCATCTACGGCTTCGCGTTGAACAGCCGCTATCTCGGCAATGCC
GACCTGCTGGAGACGGCGAAGCGCATGGCGCGCCACTTCCTCGCCCGGGTGCCGGAGGAC
GGCGTCGTGTATTGGGACTTCGAGGTGCCGCAGGAGCCGTCCTCGTACCGAGACAGCTCC
GCGTCGGCCATCACGGCATGCGGCCTGCTCGAGATCGCGAGCCAGCTTGACGAGAGCGAC
CCCGAGCGCCAGCGCTTCATCGACGCGGCGAAGACGACCGTGACGGCGCTGCGCGACGGC
TACGCCGAGCGCGACGACGGCGAAGCCGAAGGCTTCATCCGCCGCGGCTCCTATCACGTG
CGCGGCGGCATCTCGCCCGACGACTACACGATCTGGGGCGATTATTATTACCTGGAAGCG
CTGCTGCGTCTGGAGCGCGGCGTGACGGGGTATTGGTACGAGCGCGGACGTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9RC92
UniProtKB Entry NameUGL_BACGL
GenBank Gene IDAB019619
General References
  1. Hashimoto W, Kobayashi E, Nankai H, Sato N, Miya T, Kawai S, Murata K: Unsaturated glucuronyl hydrolase of Bacillus sp. GL1: novel enzyme prerequisite for metabolism of unsaturated oligosaccharides produced by polysaccharide lyases. Arch Biochem Biophys. 1999 Aug 15;368(2):367-74. [PubMed:10441389]
  2. Nakamichi Y, Maruyama Y, Mikami B, Hashimoto W, Murata K: Structural determinants in streptococcal unsaturated glucuronyl hydrolase for recognition of glycosaminoglycan sulfate groups. J Biol Chem. 2011 Feb 25;286(8):6262-71. doi: 10.1074/jbc.M110.182618. Epub 2010 Dec 8. [PubMed:21147778]
  3. Itoh T, Akao S, Hashimoto W, Mikami B, Murata K: Crystal structure of unsaturated glucuronyl hydrolase, responsible for the degradation of glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A resolution. J Biol Chem. 2004 Jul 23;279(30):31804-12. Epub 2004 May 17. [PubMed:15148314]
  4. Itoh T, Hashimoto W, Mikami B, Murata K: Substrate recognition by unsaturated glucuronyl hydrolase from Bacillus sp. GL1. Biochem Biophys Res Commun. 2006 May 26;344(1):253-62. [PubMed:16630576]
  5. Itoh T, Hashimoto W, Mikami B, Murata K: Crystal structure of unsaturated glucuronyl hydrolase complexed with substrate: molecular insights into its catalytic reaction mechanism. J Biol Chem. 2006 Oct 6;281(40):29807-16. Epub 2006 Aug 7. [PubMed:16893885]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB044471,4-DithiothreitolexperimentalunknownDetails