Solute carrier family 23 member 1

Details

Name
Solute carrier family 23 member 1
Synonyms
  • hSVCT1
  • Na(+)/L-ascorbic acid transporter 1
  • Sodium-dependent vitamin C transporter 1
  • SVCT1
  • Yolk sac permease-like molecule 3
  • YSPL3
Gene Name
SLC23A1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0036964|Solute carrier family 23 member 1
MRAQEDLEGRTQHETTRDPSTPLPTEPKFDMLYKIEDVPPWYLCILLGFQHYLTCFSGTI
AVPFLLAEALCVGHDQHMVSQLIGTIFTCVGITTLIQTTVGIRLPLFQASAFAFLVPAKA
ILALERWKCPPEEEIYGNWSLPLNTSHIWHPRIREVQGAIMVSSVVEVVIGLLGLPGALL
NYIGPLTVTPTVSLIGLSVFQAAGDRAGSHWGISACSILLIILFSQYLRNLTFLLPVYRW
GKGLTLLRIQIFKMFPIMLAIMTVWLLCYVLTLTDVLPTDPKAYGFQARTDARGDIMAIA
PWIRIPYPCQWGLPTVTAAAVLGMFSATLAGIIESIGDYYACARLAGAPPPPVHAINRGI
FTEGICCIIAGLLGTGNGSTSSSPNIGVLGITKVGSRRVVQYGAAIMLVLGTIGKFTALF
SSLPDPILGGMFCTLFGMITAVGLSNLQFVDMNSSRNLFVLGFSMFFGLTLPNYLESNPG
AINTGILEVDQILIVLLTTEMFVGGCLAFILDNTVPGSPEERGLIQWKAGAHANSDMSSS
LKSYDFPIGMGIVKRITFLKYIPICPVFKGFSSSSKDQIAIPEDTPENTETASVCTKV
Number of residues
598
Molecular Weight
64830.445
Theoretical pI
6.58
GO Classification
Functions
dehydroascorbic acid transporter activity / L-ascorbate / L-ascorbic acid transporter activity / nucleobase transmembrane transporter activity / sodium ion transmembrane transporter activity / sodium-dependent L-ascorbate transmembrane transporter activity
Processes
brain development / dehydroascorbic acid transport / L-ascorbic acid metabolic process / L-ascorbic acid transport / lung development / nucleobase transport / nucleobase-containing compound metabolic process / response to toxic substance / small molecule metabolic process / sodium ion transmembrane transport / sodium ion transport / transepithelial L-ascorbic acid transport / vitamin metabolic process / vitamin transmembrane transport / water-soluble vitamin metabolic process
Components
apical plasma membrane / basal plasma membrane / cytoplasm / extracellular exosome / integral component of plasma membrane / intracellular organelle / membrane / plasma membrane
General Function
Sodium-dependent l-ascorbate transmembrane transporter activity
Specific Function
Sodium/ascorbate cotransporter. Mediates electrogenic uptake of vitamin C, with a stoichiometry of 2 Na(+) for each ascorbate.
Pfam Domain Function
Transmembrane Regions
53-73 82-102 104-124 160-180 208-225 251-271 313-333 359-379 403-423 427-447 458-478 491-511
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0009982|Solute carrier family 23 member 1 (SLC23A1)
ATGAGGGCCCAGGAGGACCTCGAGGGCCGGACACAGCATGAAACCACCAGGGACCCCTCG
ACCCCGCTACCCACAGAGCCTAAGTTTGACATGTTGTACAAGATCGAGGACGTGCCACCT
TGGTACCTGTGCATCCTGCTGGGCTTCCAGCACTACCTGACATGCTTCAGTGGTACCATC
GCCGTGCCCTTCCTGCTGGCTGAGGCGCTGTGTGTGGGCCACGACCAGCACATGGTTAGT
CAGCTCATCGGCACCATCTTCACGTGCGTGGGCATCACCACTCTCATCCAGACCACCGTG
GGCATCCGGCTGCCGCTGTTCCAGGCCAGTGCCTTTGCATTTCTGGTTCCAGCCAAAGCC
ATACTGGCTCTGGAGAGATGGAAATGCCCCCCGGAAGAGGAGATCTACGGTAACTGGAGT
CTGCCCCTGAACACCTCTCATATTTGGCACCCACGGATACGGGAGGTCCAGGGTGCAATC
ATGGTGTCCAGCGTGGTGGAGGTGGTGATTGGCCTGCTGGGGCTGCCTGGGGCCCTGCTC
AACTACATTGGGCCTCTCACAGTCACCCCCACTGTCTCCCTCATTGGCCTTTCTGTCTTC
CAAGCTGCTGGCGACCGAGCTGGCTCCCACTGGGGCATCTCAGCTTGCTCCATTCTCCTG
ATCATCCTCTTCTCCCAGTACCTGCGCAACCTCACCTTCCTGCTGCCTGTCTACCGCTGG
GGCAAGGGCCTCACTCTCCTCCGCATCCAGATCTTCAAAATGTTTCCTATCATGCTGGCC
ATCATGACCGTGTGGCTGCTCTGCTATGTCCTGACCTTGACAGACGTGCTGCCCACAGAC
CCAAAAGCCTATGGCTTCCAGGCACGAACCGATGCCCGTGGTGACATCATGGCTATTGCA
CCCTGGATCCGCATCCCCTACCCCTGTCAGTGGGGCCTGCCCACGGTGACTGCGGCTGCT
GTCCTGGGAATGTTCAGCGCCACTCTGGCAGGCATCATTGAGTCCATCGGAGATTACTAC
GCCTGTGCCCGCCTGGCTGGTGCACCACCCCCTCCAGTACATGCTATCAACAGGGGCATC
TTCACCGAAGGCATTTGCTGCATCATCGCGGGGCTATTGGGCACGGGCAACGGGTCCACC
TCGTCCAGTCCCAACATTGGCGTCCTGGGAATTACCAAGGTGGGCAGCCGGCGCGTGGTG
CAGTATGGTGCGGCTATCATGCTGGTCCTGGGCACCATCGGCAAGTTCACGGCCCTCTTC
GCCTCGCTCCCTGACCCCATCCTGGGGGGCATGTTCTGCACTCTCTTTGGCATGATTACA
GCTGTGGGGCTGTCCAACCTGCAATTTGTGGACATGAACTCCTCTCGCAACCTCTTCGTG
CTGGGATTTTCCATGTTCTTCGGGCTCACGCTGCCCAATTACCTGGAGTCCAACCCTGGC
GCCATCAATACAGGCATTCTTGAAGTGGATCAGATTCTGATTGTGCTGCTGACCACGGAG
ATGTTTGTGGGCGGGTGCCTTGCTTTCATACTTGACAACACAGTGCCAGGGAGCCCAGAG
GAGCGTGGTCTGATACAGTGGAAAGCTGGGGCTCATGCCAACAGTGACATGTCTTCCAGC
CTCAAGAGCTACGATTTCCCCATTGGGATGGGCATAGTAAAAAGAATTACCTTTCTGAAA
TACATTCCTATCTGCCCAGTCTTCAAAGGATTTTCTTCAAGTTCAAAAGATCAGATTGCA
ATTCCAGAAGACACTCCAGAAAATACAGAAACTGCATCTGTGTGCACCAAGGTCTGA
Chromosome Location
5
Locus
5q31.2-q31.3
External Identifiers
ResourceLink
UniProtKB IDQ9UHI7
UniProtKB Entry NameS23A1_HUMAN
GenBank Protein ID3789785
GenBank Gene IDAF058317
GenAtlas IDSLC23A1
HGNC IDHGNC:10974
General References
  1. Faaland CA, Race JE, Ricken G, Warner FJ, Williams WJ, Holtzman EJ: Molecular characterization of two novel transporters from human and mouse kidney and from LLC-PK1 cells reveals a novel conserved family that is homologous to bacterial and Aspergillus nucleobase transporters. Biochim Biophys Acta. 1998 Nov 8;1442(2-3):353-60. [PubMed:9804989]
  2. Wang H, Dutta B, Huang W, Devoe LD, Leibach FH, Ganapathy V, Prasad PD: Human Na(+)-dependent vitamin C transporter 1 (hSVCT1): primary structure, functional characteristics and evidence for a non-functional splice variant. Biochim Biophys Acta. 1999 Nov 9;1461(1):1-9. [PubMed:10556483]
  3. Daruwala R, Song J, Koh WS, Rumsey SC, Levine M: Cloning and functional characterization of the human sodium-dependent vitamin C transporters hSVCT1 and hSVCT2. FEBS Lett. 1999 Nov 5;460(3):480-4. [PubMed:10556521]
  4. Wang Y, Mackenzie B, Tsukaguchi H, Weremowicz S, Morton CC, Hediger MA: Human vitamin C (L-ascorbic acid) transporter SVCT1. Biochem Biophys Res Commun. 2000 Jan 19;267(2):488-94. [PubMed:10631088]
  5. Erichsen HC, Eck P, Levine M, Chanock S: Characterization of the genomic structure of the human vitamin C transporter SVCT1 (SLC23A2). J Nutr. 2001 Oct;131(10):2623-7. [PubMed:11584081]
  6. Liang WJ, Johnson D, Jarvis SM: Vitamin C transport systems of mammalian cells. Mol Membr Biol. 2001 Jan-Mar;18(1):87-95. [PubMed:11396616]
  7. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022]
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  9. Velho AM, Jarvis SM: Topological studies of hSVCT1, the human sodium-dependent vitamin C transporter and the influence of N-glycosylation on its intracellular targeting. Exp Cell Res. 2009 Aug 1;315(13):2312-21. doi: 10.1016/j.yexcr.2009.04.007. Epub 2009 Apr 18. [PubMed:19379732]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00126Ascorbic acidapproved, nutraceuticalunknownsubstrateDetails