Release factor glutamine methyltransferase

Details

Name
Release factor glutamine methyltransferase
Synonyms
  • 2.1.1.297
  • N5-glutamine methyltransferase PrmC
  • Protein-(glutamine-N5) MTase PrmC
  • Protein-glutamine N-methyltransferase PrmC
  • RF MTase
Gene Name
prmC
Organism
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Amino acid sequence
>lcl|BSEQ0011793|Release factor glutamine methyltransferase
MDTRKNVSGAERKIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSP
TEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKY
GIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEF
LEPFKEKFASIEMILSNPPYVKSSAHLPKDVLFEPPEALFGGEDGLDFYREFFGRYDTSG
KIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS
Number of residues
282
Molecular Weight
31609.085
Theoretical pI
5.19
GO Classification
Functions
nucleic acid binding / protein-glutamine N-methyltransferase activity
Processes
peptidyl-glutamine methylation
General Function
Protein-glutamine n-methyltransferase activity
Specific Function
Methylates the class 1 translation termination release factors RF1/PrfA and RF2/PrfB on the glutamine residue of the universally conserved GGQ motif.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0011794|Release factor glutamine methyltransferase (prmC)
ATGGACACCAGAAAGAATGTCTCCGGAGCTGAGAGAAAAATTTGGAGTCTGATAAGAGAC
TGCTCTGGAAAACTCGAGGGAGTGACCGAAACTTCTGTTCTTGAGGTGTTACTCATCGTT
TCCCGGGTGCTTGGGATCCGCAAGGAAGATCTCTTTTTGAAAGACCTGGGAGTTTCTCCA
ACTGAGGAAAAAAGGATTCTGGAACTCGTGGAGAAAAGAGCAAGTGGATATCCCCTGCAC
TATATCCTCGGTGAGAAAGAGTTCATGGGCCTTTCTTTCCTCGTGGAAGAAGGCGTTTTT
GTTCCAAGGCCGGAGACGGAGGAACTGGTCGAACTCGCCCTCGAGCTGATAAGAAAGTAC
GGAATAAAGACAGTCGCAGACATAGGAACAGGAAGCGGAGCCATTGGAGTGAGCGTTGCG
AAGTTCTCCGATGCGATCGTTTTCGCGACGGACGTTTCTTCCAAAGCCGTTGAAATCGCC
AGAAAAAACGCGGAAAGACACGGTGTTTCCGACAGATTCTTTGTGAGAAAAGGTGAGTTT
CTTGAACCGTTCAAAGAAAAATTCGCATCGATCGAGATGATCCTTTCGAATCCTCCATAC
GTGAAATCGAGTGCTCATCTGCCAAAAGATGTTCTTTTCGAGCCTCCAGAGGCACTTTTT
GGAGGAGAGGACGGTCTTGACTTTTACAGAGAATTTTTCGGCAGGTACGATACGAGCGGA
AAGATTGTGCTGATGGAGATAGGAGAAGACCAGGTGGAGGAGTTGAAAAAGATCGTTTCC
GACACTGTTTTCCTGAAGGATTCCGCCGGAAAGTACCGTTTTCTCCTTCTCAACCGGCGT
TCCTCTTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9WYV8
UniProtKB Entry NamePRMC_THEMA
GenBank Gene IDAE000512
General References
  1. Nelson KE, Clayton RA, Gill SR, Gwinn ML, Dodson RJ, Haft DH, Hickey EK, Peterson JD, Nelson WC, Ketchum KA, McDonald L, Utterback TR, Malek JA, Linher KD, Garrett MM, Stewart AM, Cotton MD, Pratt MS, Phillips CA, Richardson D, Heidelberg J, Sutton GG, Fleischmann RD, Eisen JA, White O, Salzberg SL, Smith HO, Venter JC, Fraser CM: Evidence for lateral gene transfer between Archaea and bacteria from genome sequence of Thermotoga maritima. Nature. 1999 May 27;399(6734):323-9. [PubMed:10360571]
  2. Yoon HJ, Kang KY, Ahn HJ, Shim SM, Ha JY, Lee SK, Mikami B, Suh SW: X-ray crystallographic studies of HemK from Thermotoga maritima, an N5-glutamine methyltransferase. Mol Cells. 2003 Oct 31;16(2):266-9. [PubMed:14651272]
  3. Schubert HL, Phillips JD, Hill CP: Structures along the catalytic pathway of PrmC/HemK, an N5-glutamine AdoMet-dependent methyltransferase. Biochemistry. 2003 May 20;42(19):5592-9. [PubMed:12741815]
  4. Agarwal R, Burley SK, Swaminathan S: A novel mode of dimerization via formation of a glutamate anhydride crosslink in a protein crystal structure. Proteins. 2008 May 1;71(2):1038-41. doi: 10.1002/prot.21962. [PubMed:18247349]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails
DB03473N5-MethylglutamineexperimentalunknownDetails