Ribosomal RNA small subunit methyltransferase H

Details

Name
Ribosomal RNA small subunit methyltransferase H
Synonyms
  • 16S rRNA m(4)C1402 methyltransferase
  • 2.1.1.199
  • mraW
  • rRNA (cytosine-N(4)-)-methyltransferase RsmH
Gene Name
rsmH
Organism
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Amino acid sequence
>lcl|BSEQ0016811|Ribosomal RNA small subunit methyltransferase H
MRKYSQRHIPVMVREVIEFLKPEDEKIILDCTVGEGGHSRAILEHCPGCRIIGIDVDSEV
LRIAEEKLKEFSDRVSLFKVSYREADFLLKTLGIEKVDGILMDLGVSTYQLKGENRGFTF
EREEPLDMRMDLESEVTAQKVLNELPEEELARIIFEYGEEKRFARRIARKIVENRPLNTT
LDLVKAVREALPSYEIRRRKRHFATKTFQAIRIYVNRELENLKEFLKKAEDLLNPGGRIV
VISFHSLEDRIVKETFRNSKKLRILTEKPVRPSEEEIRENPRARSGRLRAAERIEEGGD
Number of residues
299
Molecular Weight
34892.82
Theoretical pI
8.07
GO Classification
Functions
rRNA (cytosine-N4-)-methyltransferase activity
Processes
rRNA base methylation
Components
cytoplasm
General Function
Rrna (cytosine-n4-)-methyltransferase activity
Specific Function
Specifically methylates the N4 position of cytidine in position 1402 (C1402) of 16S rRNA.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0016812|Ribosomal RNA small subunit methyltransferase H (rsmH)
ATGCGGAAATATTCGCAGCGACATATTCCTGTAATGGTTAGAGAAGTTATTGAGTTTCTG
AAACCGGAGGATGAGAAAATCATCCTCGATTGCACGGTAGGTGAAGGAGGACACTCTAGA
GCGATTTTGGAACACTGTCCGGGATGCAGAATCATAGGAATAGACGTTGATTCAGAAGTT
TTGCGGATCGCAGAAGAGAAATTGAAAGAATTCTCAGATCGTGTGAGTTTGTTCAAAGTC
TCCTACAGAGAAGCGGATTTTCTTCTTAAAACTTTAGGAATAGAAAAAGTAGATGGGATA
TTAATGGATCTTGGGGTTTCTACTTATCAACTCAAAGGAGAGAATCGGGGATTCACGTTC
GAGAGAGAAGAACCACTGGATATGCGTATGGATCTGGAAAGCGAAGTAACGGCTCAAAAG
GTATTGAATGAGTTACCGGAAGAGGAGTTAGCGAGGATAATCTTTGAGTACGGTGAAGAA
AAGAGATTCGCAAGGAGAATCGCCCGAAAGATCGTTGAAAATCGTCCCCTCAACACCACC
CTTGACCTTGTTAAAGCTGTGAGAGAAGCGCTTCCATCTTACGAGATCAGACGCCGCAAG
AGACACTTTGCAACGAAGACGTTCCAGGCTATAAGAATCTATGTCAACAGAGAACTTGAA
AATCTGAAAGAATTTCTGAAAAAAGCGGAGGATCTTCTAAACCCTGGTGGCAGAATAGTG
GTCATTTCCTTTCATTCTCTGGAGGATAGGATCGTCAAAGAGACGTTCAGAAATTCTAAA
AAGTTACGAATATTGACGGAAAAACCTGTTCGTCCTTCAGAAGAGGAAATAAGAGAAAAT
CCAAGAGCCAGGAGCGGACGTTTGCGCGCAGCGGAGCGGATAGAGGAAGGAGGAGATTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9WZX6
UniProtKB Entry NameRSMH_THEMA
GenBank Gene IDAE000512
General References
  1. Nelson KE, Clayton RA, Gill SR, Gwinn ML, Dodson RJ, Haft DH, Hickey EK, Peterson JD, Nelson WC, Ketchum KA, McDonald L, Utterback TR, Malek JA, Linher KD, Garrett MM, Stewart AM, Cotton MD, Pratt MS, Phillips CA, Richardson D, Heidelberg J, Sutton GG, Fleischmann RD, Eisen JA, White O, Salzberg SL, Smith HO, Venter JC, Fraser CM: Evidence for lateral gene transfer between Archaea and bacteria from genome sequence of Thermotoga maritima. Nature. 1999 May 27;399(6734):323-9. [PubMed:10360571]
  2. Miller DJ, Ouellette N, Evdokimova E, Savchenko A, Edwards A, Anderson WF: Crystal complexes of a predicted S-adenosylmethionine-dependent methyltransferase reveal a typical AdoMet binding domain and a substrate recognition domain. Protein Sci. 2003 Jul;12(7):1432-42. [PubMed:12824489]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails