Chorismate mutase AroH
Details
- Name
- Chorismate mutase AroH
- Synonyms
- 5.4.99.5
- CM
- Gene Name
- aroH
- Organism
- Bacillus subtilis (strain 168)
- Amino acid sequence
>lcl|BSEQ0011055|Chorismate mutase AroH MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAK AVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKVVVLRPDLS LTKNTEL
- Number of residues
- 127
- Molecular Weight
- 14516.91
- Theoretical pI
- 5.7
- GO Classification
- Functionschorismate mutase activityProcessesaromatic amino acid family biosynthetic process / chorismate metabolic processComponentscytoplasm
- General Function
- Chorismate mutase activity
- Specific Function
- Catalyzes the Claisen rearrangement of chorismate to prephenate. Probably involved in the aromatic amino acid biosynthesis.
- Pfam Domain Function
- CM_1 (PF07736)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0011056|Chorismate mutase AroH (aroH) ATGATGATTCGCGGAATTCGCGGAGCAACTACAGTTGAACGGGATACTGAAGAAGAAATT TTACAAAAAACTAAACAGCTGTTAGAGAAAATCATAGAAGAAAATCATACAAAACCGGAA GATGTTGTTCAAATGCTTCTGTCGGCTACACCTGATTTGCACGCTGTTTTCCCGGCAAAA GCTGTTCGCGAGCTTTCAGGATGGCAGTATGTACCGGTAACATGTATGCAGGAAATGGAC GTAACAGGCGGTCTGAAAAAGTGCATAAGAGTCATGATGACGGTCCAGACAGATGTCCCT CAGGATCAGATCAGACATGTATATTTAGAAAAAGTTGTCGTATTGAGGCCCGATTTATCA TTGACAAAAAATACTGAATTGTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P19080 UniProtKB Entry Name AROH_BACSU GenBank Protein ID 142536 GenBank Gene ID M32278 - General References
- Gray JV, Golinelli-Pimpaneau B, Knowles JR: Monofunctional chorismate mutase from Bacillus subtilis: purification of the protein, molecular cloning of the gene, and overexpression of the gene product in Escherichia coli. Biochemistry. 1990 Jan 16;29(2):376-83. [Article]
- Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [Article]
- Rajagopalan JS, Taylor KM, Jaffe EK: 13C NMR studies of the enzyme-product complex of Bacillus subtilis chorismate mutase. Biochemistry. 1993 Apr 20;32(15):3965-72. [Article]
- Chook YM, Ke H, Lipscomb WN: Crystal structures of the monofunctional chorismate mutase from Bacillus subtilis and its complex with a transition state analog. Proc Natl Acad Sci U S A. 1993 Sep 15;90(18):8600-3. [Article]
- Chook YM, Gray JV, Ke H, Lipscomb WN: The monofunctional chorismate mutase from Bacillus subtilis. Structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications for the mechanism of the enzymatic reaction. J Mol Biol. 1994 Jul 29;240(5):476-500. [Article]
- Ladner JE, Reddy P, Davis A, Tordova M, Howard AJ, Gilliland GL: The 1.30 A resolution structure of the Bacillus subtilis chorismate mutase catalytic homotrimer. Acta Crystallogr D Biol Crystallogr. 2000 Jun;56(Pt 6):673-83. [Article]
- Kast P, Grisostomi C, Chen IA, Li S, Krengel U, Xue Y, Hilvert D: A strategically positioned cation is crucial for efficient catalysis by chorismate mutase. J Biol Chem. 2000 Nov 24;275(47):36832-8. [Article]