You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameEtanercept
Accession NumberDB00005  (BTD00052, BIOD00052)
TypeBiotech
GroupsApproved, Investigational
DescriptionDimeric fusion protein consisting of the extracellular ligand-binding portion of the human 75 kilodalton (p75) tumor necrosis factor receptor (TNFR) linked to the Fc portion of human IgG1. The Fc component of etanercept contains the CH2 domain, the CH3 domain and hinge region, but not the CH1 domain of IgG1. Etanercept is produced by recombinant DNA technology in a Chinese hamster ovary (CHO) mammalian cell expression system. It consists of 934 amino acids
Protein structureDb00005
Related Articles
Protein chemical formulaC2224H3475N621O698S36
Protein average weight51234.9 Da
Sequences
> Etanercept Sequence
LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDST
YTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRK
CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTS
TSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDEPKSC
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD
GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
CD120b
p75
p80 TNF-alpha receptor
TNF-R2
Tumor necrosis factor receptor 2
Tumor necrosis factor receptor superfamily member 1B precursor
Tumor necrosis factor receptor type II
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
EnbrelkitImmunex Corporation2003-01-02Not applicableUs
Enbrelsolution50 mgsubcutaneousImmunex Corporation2005-12-21Not applicableCanada
Enbrelsolution50 mg/mLsubcutaneousImmunex Corporation2005-10-06Not applicableUs
Enbrelsolution50 mg/mLsubcutaneousImmunex Corporation2005-11-10Not applicableUs
Enbrelsolution25 mg/.5mLsubcutaneousImmunex Corporation2005-11-10Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
Enbrel SureclickNot Available
Brand mixtures
NameLabellerIngredients
EnbrelImmunex Corporation
SaltsNot Available
Categories
UNIIOP401G7OJC
CAS number185243-69-0
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor treatment of severe active rheumatoid arthritis in adults, severe juvenile idiopathic arthritis, ankylosing spondylitis, and severe plaque psoriasis.
PharmacodynamicsTumor necrosis factor TNF is a naturally occurring cytokine that is involved in normal inflammatory and immune responses. Elevated levels of TNF are found in tissues and fluids of patients with rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis (AS), and plaque psoriasis. Etanercept binds specifically to tumor necrosis factor (TNF) and blocks its interaction with cell surface TNF receptors.
Mechanism of actionThere are two distinct receptors for TNF (TNFRs), a 55 kilodalton protein (p55) and a 75 kilodalton protein (p75). The biological activity of TNF is dependent upon binding to either cell surface receptor (p75 or p55). Etanercept is a dimeric soluble form of the p75 TNF receptor that can bind to two TNF molecules, thereby effectively removing them from circulation.
Related Articles
AbsorptionBioavailability following sub-Q administration is approximately 60%. Peak plasma concentrations achieved within 69 hours.
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half life102 +/- 30 hrs in individuals with rheumatoid arthritis and 68 hours in healthy adults
Clearance
  • 160 +/- 80 mL/hr [RA patients]
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Amgen Inc. + Wyeth + Takeda
Packagers
Dosage forms
FormRouteStrength
Kit
Kit; liquid; powder for solutionsubcutaneous
Solutionsubcutaneous25 mg/.5mL
Solutionsubcutaneous50 mg
Solutionsubcutaneous50 mg/mL
Prices
Unit descriptionCostUnit
Enbrel (1 Box = 1 Kit = Four 50 mg Syringes) 3.92ml Box2033.14USD box
Enbrel SureClick (1 Box Contains Four 50 mg Prefilled Autoinjectors)2033.14USD box
Enbrel 4 25 mg Kit (1 Box = 1 Kit = Four 25 mg Vials)1016.57USD box
Enbrel 50 mg/ml sureclick syr488.74USD syringe
Enbrel 25 mg kit250.37USD each
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2123593 No2000-03-142013-09-14Canada
CA2476934 No2009-06-162023-02-27Canada
US36755 No2000-06-272012-10-23Us
US7276477 No2007-10-022024-07-29Us
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.529Not Available
isoelectric point7.89Not Available
References
Synthesis Reference

Timothy D. Osslund, Christi L. Clogston, Shon Lee Crampton, Randal B. Bass, “Crystals of etanercept and methods of making thereof.” U.S. Patent US07276477, issued October 02, 2007.

US07276477
General References
  1. Link [Link]
  2. Link [Link]
External Links
ATC CodesL04AB01
AHFS Codes
  • 92:00.00
PDB Entries
FDA labelNot Available
MSDSNot Available
Interactions
Drug Interactions
Drug
AbataceptThe risk or severity of adverse effects can be increased when Etanercept is combined with Abatacept.
AbciximabEtanercept may increase the anticoagulant activities of Abciximab.
AcebutololEtanercept may decrease the antihypertensive activities of Acebutolol.
AceclofenacThe risk or severity of adverse effects can be increased when Etanercept is combined with Aceclofenac.
AcenocoumarolEtanercept may increase the anticoagulant activities of Acenocoumarol.
Acetylsalicylic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Acetylsalicylic acid.
AdapaleneThe risk or severity of adverse effects can be increased when Etanercept is combined with Adapalene.
Alendronic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Alendronic acid.
AliskirenEtanercept may decrease the antihypertensive activities of Aliskiren.
AlprenololEtanercept may decrease the antihypertensive activities of Alprenolol.
AlprostadilThe therapeutic efficacy of Alprostadil can be decreased when used in combination with Etanercept.
AmikacinEtanercept may decrease the excretion rate of Amikacin which could result in a lower serum level and potentially a reduction in efficacy.
AmilorideEtanercept may decrease the antihypertensive activities of Amiloride.
AnakinraThe risk or severity of adverse effects can be increased when Etanercept is combined with Anakinra.
AncrodEtanercept may increase the anticoagulant activities of Ancrod.
AntipyrineThe risk or severity of adverse effects can be increased when Etanercept is combined with Antipyrine.
Antithrombin III humanEtanercept may increase the anticoagulant activities of Antithrombin III human.
ApixabanEtanercept may increase the anticoagulant activities of Apixaban.
ApremilastThe risk or severity of adverse effects can be increased when Etanercept is combined with Apremilast.
ArdeparinEtanercept may increase the anticoagulant activities of Ardeparin.
ArgatrobanEtanercept may increase the anticoagulant activities of Argatroban.
ArotinololEtanercept may decrease the antihypertensive activities of Arotinolol.
AtenololEtanercept may decrease the antihypertensive activities of Atenolol.
AzapropazoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Azapropazone.
AzelastineThe risk or severity of adverse effects can be increased when Etanercept is combined with Azelastine.
Azilsartan medoxomilThe risk or severity of adverse effects can be increased when Azilsartan medoxomil is combined with Etanercept.
BalsalazideEtanercept may increase the nephrotoxic activities of Balsalazide.
BalsalazideThe risk or severity of adverse effects can be increased when Balsalazide is combined with Etanercept.
BecaplerminEtanercept may increase the anticoagulant activities of Becaplermin.
BefunololEtanercept may decrease the antihypertensive activities of Befunolol.
BelimumabThe risk or severity of adverse effects can be increased when Etanercept is combined with Belimumab.
BenazeprilThe risk or severity of adverse effects can be increased when Benazepril is combined with Etanercept.
BendroflumethiazideThe therapeutic efficacy of Bendroflumethiazide can be decreased when used in combination with Etanercept.
BenoxaprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Benoxaprofen.
BetaxololEtanercept may decrease the antihypertensive activities of Betaxolol.
BevantololEtanercept may decrease the antihypertensive activities of Bevantolol.
BimatoprostThe therapeutic efficacy of Bimatoprost can be decreased when used in combination with Etanercept.
BisoprololEtanercept may decrease the antihypertensive activities of Bisoprolol.
BivalirudinEtanercept may increase the anticoagulant activities of Bivalirudin.
BopindololEtanercept may decrease the antihypertensive activities of Bopindolol.
BromfenacThe risk or severity of adverse effects can be increased when Etanercept is combined with Bromfenac.
BufuralolEtanercept may decrease the antihypertensive activities of Bufuralol.
BumetanideEtanercept may decrease the diuretic activities of Bumetanide.
BupranololEtanercept may decrease the antihypertensive activities of Bupranolol.
CanakinumabThe risk or severity of adverse effects can be increased when Etanercept is combined with Canakinumab.
CandesartanThe risk or severity of adverse effects can be increased when Candesartan is combined with Etanercept.
CandoxatrilThe risk or severity of adverse effects can be increased when Candoxatril is combined with Etanercept.
CaptoprilThe risk or severity of adverse effects can be increased when Captopril is combined with Etanercept.
Carboprost TromethamineThe therapeutic efficacy of Carboprost Tromethamine can be decreased when used in combination with Etanercept.
CarprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Carprofen.
CarteololEtanercept may decrease the antihypertensive activities of Carteolol.
CarvedilolEtanercept may decrease the antihypertensive activities of Carvedilol.
CastanospermineThe risk or severity of adverse effects can be increased when Etanercept is combined with Castanospermine.
CelecoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Celecoxib.
CeliprololEtanercept may decrease the antihypertensive activities of Celiprolol.
Certolizumab pegolEtanercept may increase the immunosuppressive activities of Certolizumab pegol.
CertoparinEtanercept may increase the anticoagulant activities of Certoparin.
ChloroquineThe risk or severity of adverse effects can be increased when Etanercept is combined with Chloroquine.
ChlorothiazideThe therapeutic efficacy of Chlorothiazide can be decreased when used in combination with Etanercept.
ChlorthalidoneThe therapeutic efficacy of Chlorthalidone can be decreased when used in combination with Etanercept.
CholestyramineCholestyramine can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy.
CilazaprilThe risk or severity of adverse effects can be increased when Cilazapril is combined with Etanercept.
Citric AcidEtanercept may increase the anticoagulant activities of Citric Acid.
ClodronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Clodronate.
ClonixinThe risk or severity of adverse effects can be increased when Etanercept is combined with Clonixin.
CloprostenolThe therapeutic efficacy of Cloprostenol can be decreased when used in combination with Etanercept.
ColesevelamColesevelam can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy.
ColestipolColestipol can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy.
CyclophosphamideThe risk or severity of adverse effects can be increased when Etanercept is combined with Cyclophosphamide.
CyclosporineEtanercept may increase the nephrotoxic activities of Cyclosporine.
D-LimoneneThe risk or severity of adverse effects can be increased when Etanercept is combined with D-Limonene.
Dabigatran etexilateEtanercept may increase the anticoagulant activities of Dabigatran etexilate.
DalteparinEtanercept may increase the anticoagulant activities of Dalteparin.
DanaparoidEtanercept may increase the anticoagulant activities of Danaparoid.
DaunorubicinEtanercept may decrease the excretion rate of Daunorubicin which could result in a lower serum level and potentially a reduction in efficacy.
DeferasiroxThe risk or severity of adverse effects can be increased when Etanercept is combined with Deferasirox.
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Etanercept.
DesirudinEtanercept may increase the anticoagulant activities of Desirudin.
DesmopressinThe risk or severity of adverse effects can be increased when Etanercept is combined with Desmopressin.
DexketoprofenThe risk or severity of adverse effects can be increased when Dexketoprofen is combined with Etanercept.
DextranEtanercept may increase the anticoagulant activities of Dextran.
Dextran 40Etanercept may increase the anticoagulant activities of Dextran 40.
Dextran 70Etanercept may increase the anticoagulant activities of Dextran 70.
Dextran 75Etanercept may increase the anticoagulant activities of Dextran 75.
DiclofenacThe risk or severity of adverse effects can be increased when Etanercept is combined with Diclofenac.
DicoumarolEtanercept may increase the anticoagulant activities of Dicoumarol.
DiflunisalThe risk or severity of adverse effects can be increased when Etanercept is combined with Diflunisal.
DigoxinThe serum concentration of Digoxin can be increased when it is combined with Etanercept.
DihydrostreptomycinEtanercept may decrease the excretion rate of Dihydrostreptomycin which could result in a lower serum level and potentially a reduction in efficacy.
DinoprostoneThe therapeutic efficacy of Dinoprostone can be decreased when used in combination with Etanercept.
DoxorubicinEtanercept may decrease the excretion rate of Doxorubicin which could result in a lower serum level and potentially a reduction in efficacy.
DrospirenoneEtanercept may increase the hyperkalemic activities of Drospirenone.
DroxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Droxicam.
Edetic AcidEtanercept may increase the anticoagulant activities of Edetic Acid.
EdoxabanEtanercept may increase the anticoagulant activities of Edoxaban.
EnalaprilThe risk or severity of adverse effects can be increased when Enalapril is combined with Etanercept.
EnalaprilatThe risk or severity of adverse effects can be increased when Enalaprilat is combined with Etanercept.
EnoxaparinEtanercept may increase the anticoagulant activities of Enoxaparin.
EpirizoleThe risk or severity of adverse effects can be increased when Etanercept is combined with Epirizole.
EpirubicinEtanercept may decrease the excretion rate of Epirubicin which could result in a lower serum level and potentially a reduction in efficacy.
EplerenoneEtanercept may decrease the antihypertensive activities of Eplerenone.
EpoprostenolThe therapeutic efficacy of Epoprostenol can be decreased when used in combination with Etanercept.
EprosartanThe risk or severity of adverse effects can be increased when Eprosartan is combined with Etanercept.
EsmololEtanercept may decrease the antihypertensive activities of Esmolol.
Etacrynic acidEtanercept may decrease the diuretic activities of Etacrynic acid.
Ethyl biscoumacetateEtanercept may increase the anticoagulant activities of Ethyl biscoumacetate.
Etidronic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Etidronic acid.
EtodolacThe risk or severity of adverse effects can be increased when Etanercept is combined with Etodolac.
EtofenamateThe risk or severity of adverse effects can be increased when Etanercept is combined with Etofenamate.
EtoricoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Etoricoxib.
Evening primrose oilThe risk or severity of adverse effects can be increased when Etanercept is combined with Evening primrose oil.
exisulindThe risk or severity of adverse effects can be increased when Etanercept is combined with exisulind.
FenbufenThe risk or severity of adverse effects can be increased when Etanercept is combined with Fenbufen.
FenoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Fenoprofen.
FingolimodEtanercept may increase the immunosuppressive activities of Fingolimod.
FloctafenineThe risk or severity of adverse effects can be increased when Floctafenine is combined with Etanercept.
FlunixinThe risk or severity of adverse effects can be increased when Etanercept is combined with Flunixin.
FlurbiprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Flurbiprofen.
Folic AcidThe therapeutic efficacy of Folic Acid can be decreased when used in combination with Etanercept.
Fondaparinux sodiumEtanercept may increase the anticoagulant activities of Fondaparinux sodium.
ForasartanThe risk or severity of adverse effects can be increased when Forasartan is combined with Etanercept.
FosinoprilThe risk or severity of adverse effects can be increased when Fosinopril is combined with Etanercept.
FramycetinEtanercept may decrease the excretion rate of Framycetin which could result in a lower serum level and potentially a reduction in efficacy.
FurosemideEtanercept may decrease the diuretic activities of Furosemide.
GemeprostThe therapeutic efficacy of Gemeprost can be decreased when used in combination with Etanercept.
GentamicinEtanercept may decrease the excretion rate of Gentamicin which could result in a lower serum level and potentially a reduction in efficacy.
HaloperidolThe risk or severity of adverse effects can be increased when Etanercept is combined with Haloperidol.
HeparinEtanercept may increase the anticoagulant activities of Heparin.
HirulogEtanercept may increase the anticoagulant activities of Hirulog.
HMPL-004The risk or severity of adverse effects can be increased when Etanercept is combined with HMPL-004.
HydralazineEtanercept may decrease the antihypertensive activities of Hydralazine.
HydrochlorothiazideThe therapeutic efficacy of Hydrochlorothiazide can be decreased when used in combination with Etanercept.
HydroflumethiazideThe therapeutic efficacy of Hydroflumethiazide can be decreased when used in combination with Etanercept.
Hygromycin BEtanercept may decrease the excretion rate of Hygromycin B which could result in a lower serum level and potentially a reduction in efficacy.
IbandronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Ibandronate.
IbuprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Ibuprofen.
IbuproxamThe risk or severity of adverse effects can be increased when Etanercept is combined with Ibuproxam.
IcatibantThe risk or severity of adverse effects can be increased when Etanercept is combined with Icatibant.
IdarubicinEtanercept may decrease the excretion rate of Idarubicin which could result in a lower serum level and potentially a reduction in efficacy.
IloprostThe therapeutic efficacy of Iloprost can be decreased when used in combination with Etanercept.
IndapamideThe therapeutic efficacy of Indapamide can be decreased when used in combination with Etanercept.
IndenololEtanercept may decrease the antihypertensive activities of Indenolol.
IndomethacinThe risk or severity of adverse effects can be increased when Etanercept is combined with Indomethacin.
IndoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Indoprofen.
InfliximabEtanercept may increase the immunosuppressive activities of Infliximab.
IrbesartanThe risk or severity of adverse effects can be increased when Irbesartan is combined with Etanercept.
IsoxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Isoxicam.
KanamycinEtanercept may decrease the excretion rate of Kanamycin which could result in a lower serum level and potentially a reduction in efficacy.
KebuzoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Kebuzone.
KetoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Ketoprofen.
KetorolacThe risk or severity of adverse effects can be increased when Ketorolac is combined with Etanercept.
LabetalolEtanercept may decrease the antihypertensive activities of Labetalol.
LeflunomideThe risk or severity of adverse effects can be increased when Etanercept is combined with Leflunomide.
LepirudinEtanercept may increase the anticoagulant activities of Lepirudin.
LevobunololEtanercept may decrease the antihypertensive activities of Levobunolol.
LisinoprilThe risk or severity of adverse effects can be increased when Lisinopril is combined with Etanercept.
LithiumThe serum concentration of Lithium can be increased when it is combined with Etanercept.
LornoxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Lornoxicam.
LosartanThe risk or severity of adverse effects can be increased when Losartan is combined with Etanercept.
LoxoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Loxoprofen.
LubiprostoneThe therapeutic efficacy of Lubiprostone can be decreased when used in combination with Etanercept.
LumiracoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Lumiracoxib.
Magnesium salicylateThe risk or severity of adverse effects can be increased when Etanercept is combined with Magnesium salicylate.
MasoprocolThe risk or severity of adverse effects can be increased when Etanercept is combined with Masoprocol.
Meclofenamic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Meclofenamic acid.
Mefenamic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Mefenamic acid.
MeloxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Meloxicam.
MesalazineEtanercept may increase the nephrotoxic activities of Mesalazine.
MesalazineThe risk or severity of adverse effects can be increased when Mesalazine is combined with Etanercept.
MetamizoleThe risk or severity of adverse effects can be increased when Etanercept is combined with Metamizole.
MethotrexateThe serum concentration of Methotrexate can be increased when it is combined with Etanercept.
MethyclothiazideThe therapeutic efficacy of Methyclothiazide can be decreased when used in combination with Etanercept.
MetipranololEtanercept may decrease the antihypertensive activities of Metipranolol.
MetolazoneThe therapeutic efficacy of Metolazone can be decreased when used in combination with Etanercept.
MetoprololEtanercept may decrease the antihypertensive activities of Metoprolol.
MetrizamideEtanercept may decrease the excretion rate of Metrizamide which could result in a lower serum level and potentially a reduction in efficacy.
MisoprostolThe therapeutic efficacy of Misoprostol can be decreased when used in combination with Etanercept.
MoexiprilThe risk or severity of adverse effects can be increased when Moexipril is combined with Etanercept.
MorniflumateThe risk or severity of adverse effects can be increased when Morniflumate is combined with Etanercept.
Mycophenolate mofetilThe risk or severity of adverse effects can be increased when Etanercept is combined with Mycophenolate mofetil.
Mycophenolic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Mycophenolic acid.
NabumetoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Nabumetone.
NadololEtanercept may decrease the antihypertensive activities of Nadolol.
NadroparinEtanercept may increase the anticoagulant activities of Nadroparin.
NaftifineThe risk or severity of adverse effects can be increased when Etanercept is combined with Naftifine.
NaproxenThe risk or severity of adverse effects can be increased when Etanercept is combined with Naproxen.
NatalizumabThe risk or severity of adverse effects can be increased when Etanercept is combined with Natalizumab.
NCX 4016The risk or severity of adverse effects can be increased when Etanercept is combined with NCX 4016.
NeomycinEtanercept may decrease the excretion rate of Neomycin which could result in a lower serum level and potentially a reduction in efficacy.
NepafenacThe risk or severity of adverse effects can be increased when Etanercept is combined with Nepafenac.
NetilmicinEtanercept may decrease the excretion rate of Netilmicin which could result in a lower serum level and potentially a reduction in efficacy.
Niflumic AcidThe risk or severity of adverse effects can be increased when Etanercept is combined with Niflumic Acid.
NimesulideThe risk or severity of adverse effects can be increased when Etanercept is combined with Nimesulide.
OlmesartanThe risk or severity of adverse effects can be increased when Olmesartan is combined with Etanercept.
OlopatadineThe risk or severity of adverse effects can be increased when Etanercept is combined with Olopatadine.
OlsalazineEtanercept may increase the nephrotoxic activities of Olsalazine.
OlsalazineThe risk or severity of adverse effects can be increased when Olsalazine is combined with Etanercept.
Omacetaxine mepesuccinateThe risk or severity of adverse effects can be increased when Etanercept is combined with Omacetaxine mepesuccinate.
OmapatrilatThe risk or severity of adverse effects can be increased when Omapatrilat is combined with Etanercept.
OrgoteinThe risk or severity of adverse effects can be increased when Etanercept is combined with Orgotein.
OtamixabanEtanercept may increase the anticoagulant activities of Otamixaban.
OxaprozinThe risk or severity of adverse effects can be increased when Etanercept is combined with Oxaprozin.
OxprenololEtanercept may decrease the antihypertensive activities of Oxprenolol.
OxyphenbutazoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Oxyphenbutazone.
PamidronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Pamidronate.
ParecoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Parecoxib.
ParomomycinEtanercept may decrease the excretion rate of Paromomycin which could result in a lower serum level and potentially a reduction in efficacy.
PenbutololEtanercept may decrease the antihypertensive activities of Penbutolol.
Pentosan PolysulfateEtanercept may increase the anticoagulant activities of Pentosan Polysulfate.
PerindoprilThe risk or severity of adverse effects can be increased when Perindopril is combined with Etanercept.
PhenindioneEtanercept may increase the anticoagulant activities of Phenindione.
PhenprocoumonEtanercept may increase the anticoagulant activities of Phenprocoumon.
PhenylbutazoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Phenylbutazone.
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Etanercept.
PindololEtanercept may decrease the antihypertensive activities of Pindolol.
PiretanideEtanercept may decrease the diuretic activities of Piretanide.
PirfenidoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Pirfenidone.
PiroxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Piroxicam.
PlicamycinEtanercept may decrease the excretion rate of Plicamycin which could result in a lower serum level and potentially a reduction in efficacy.
PolythiazideThe therapeutic efficacy of Polythiazide can be decreased when used in combination with Etanercept.
PractololEtanercept may decrease the antihypertensive activities of Practolol.
PralatrexateThe serum concentration of Pralatrexate can be increased when it is combined with Etanercept.
ProbenecidThe serum concentration of Etanercept can be increased when it is combined with Probenecid.
PropacetamolThe risk or severity of adverse effects can be increased when Etanercept is combined with Propacetamol.
PropranololEtanercept may decrease the antihypertensive activities of Propranolol.
Prostaglandin D2The therapeutic efficacy of Prostaglandin D2 can be decreased when used in combination with Etanercept.
Protein CEtanercept may increase the anticoagulant activities of Protein C.
ProtocatechualdehydeEtanercept may increase the anticoagulant activities of Protocatechualdehyde.
PTC299The risk or severity of adverse effects can be increased when Etanercept is combined with PTC299.
PuromycinEtanercept may decrease the excretion rate of Puromycin which could result in a lower serum level and potentially a reduction in efficacy.
QuinaprilThe risk or severity of adverse effects can be increased when Quinapril is combined with Etanercept.
QuinethazoneThe therapeutic efficacy of Quinethazone can be decreased when used in combination with Etanercept.
Rabies vaccineThe risk or severity of adverse effects can be increased when Etanercept is combined with Rabies vaccine.
RamiprilThe risk or severity of adverse effects can be increased when Ramipril is combined with Etanercept.
RescinnamineThe risk or severity of adverse effects can be increased when Rescinnamine is combined with Etanercept.
ResveratrolThe risk or severity of adverse effects can be increased when Etanercept is combined with Resveratrol.
ReviparinEtanercept may increase the anticoagulant activities of Reviparin.
RibostamycinEtanercept may decrease the excretion rate of Ribostamycin which could result in a lower serum level and potentially a reduction in efficacy.
RilonaceptThe risk or severity of adverse effects can be increased when Etanercept is combined with Rilonacept.
RisedronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Risedronate.
RivaroxabanEtanercept may increase the anticoagulant activities of Rivaroxaban.
RofecoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Rofecoxib.
RoflumilastRoflumilast may increase the immunosuppressive activities of Etanercept.
SalicylamideThe risk or severity of adverse effects can be increased when Etanercept is combined with Salicylamide.
Salicylic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Salicylic acid.
SalsalateThe risk or severity of adverse effects can be increased when Etanercept is combined with Salsalate.
SaprisartanThe risk or severity of adverse effects can be increased when Saprisartan is combined with Etanercept.
SaralasinThe risk or severity of adverse effects can be increased when Saralasin is combined with Etanercept.
SeratrodastThe risk or severity of adverse effects can be increased when Etanercept is combined with Seratrodast.
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Etanercept.
SotalolEtanercept may decrease the antihypertensive activities of Sotalol.
SpectinomycinEtanercept may decrease the excretion rate of Spectinomycin which could result in a lower serum level and potentially a reduction in efficacy.
SpiraprilThe risk or severity of adverse effects can be increased when Spirapril is combined with Etanercept.
SpironolactoneEtanercept may decrease the antihypertensive activities of Spironolactone.
SRT501The risk or severity of adverse effects can be increased when Etanercept is combined with SRT501.
StreptomycinEtanercept may decrease the excretion rate of Streptomycin which could result in a lower serum level and potentially a reduction in efficacy.
StreptozocinEtanercept may decrease the excretion rate of Streptozocin which could result in a lower serum level and potentially a reduction in efficacy.
SulfasalazineEtanercept may increase the nephrotoxic activities of Sulfasalazine.
SulfasalazineThe risk or severity of adverse effects can be increased when Sulfasalazine is combined with Etanercept.
SulindacThe risk or severity of adverse effects can be increased when Etanercept is combined with Sulindac.
SulodexideEtanercept may increase the anticoagulant activities of Sulodexide.
SuprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Suprofen.
TacrolimusThe risk or severity of adverse effects can be increased when Tacrolimus is combined with Etanercept.
TacrolimusEtanercept may increase the nephrotoxic activities of Tacrolimus.
TalniflumateThe risk or severity of adverse effects can be increased when Talniflumate is combined with Etanercept.
TasosartanThe risk or severity of adverse effects can be increased when Tasosartan is combined with Etanercept.
Technetium Tc-99m MedronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Technetium Tc-99m Medronate.
TelmisartanThe risk or severity of adverse effects can be increased when Telmisartan is combined with Etanercept.
TemocaprilThe risk or severity of adverse effects can be increased when Temocapril is combined with Etanercept.
TenofovirThe risk or severity of adverse effects can be increased when Etanercept is combined with Tenofovir.
TenoxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Tenoxicam.
TepoxalinThe risk or severity of adverse effects can be increased when Etanercept is combined with Tepoxalin.
TeriflunomideThe risk or severity of adverse effects can be increased when Etanercept is combined with Teriflunomide.
Tiaprofenic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Tiaprofenic acid.
TiludronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Tiludronate.
TimololEtanercept may decrease the antihypertensive activities of Timolol.
TobramycinEtanercept may decrease the excretion rate of Tobramycin which could result in a lower serum level and potentially a reduction in efficacy.
TocilizumabTocilizumab may increase the immunosuppressive activities of Etanercept.
TofacitinibThe risk or severity of adverse effects can be increased when Etanercept is combined with Tofacitinib.
Tolfenamic AcidThe risk or severity of adverse effects can be increased when Etanercept is combined with Tolfenamic Acid.
TolmetinThe risk or severity of adverse effects can be increased when Etanercept is combined with Tolmetin.
TorasemideEtanercept may decrease the diuretic activities of Torasemide.
TrandolaprilThe risk or severity of adverse effects can be increased when Trandolapril is combined with Etanercept.
TranilastThe risk or severity of adverse effects can be increased when Etanercept is combined with Tranilast.
TrastuzumabTrastuzumab may increase the neutropenic activities of Etanercept.
TravoprostThe therapeutic efficacy of Travoprost can be decreased when used in combination with Etanercept.
TreprostinilThe risk or severity of adverse effects can be increased when Treprostinil is combined with Etanercept.
TriamtereneEtanercept may decrease the antihypertensive activities of Triamterene.
TrichlormethiazideThe therapeutic efficacy of Trichlormethiazide can be decreased when used in combination with Etanercept.
Trisalicylate-cholineThe risk or severity of adverse effects can be increased when Etanercept is combined with Trisalicylate-choline.
ValdecoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Valdecoxib.
ValsartanThe risk or severity of adverse effects can be increased when Valsartan is combined with Etanercept.
VancomycinThe serum concentration of Vancomycin can be increased when it is combined with Etanercept.
VedolizumabThe risk or severity of adverse effects can be increased when Etanercept is combined with Vedolizumab.
WarfarinEtanercept may increase the anticoagulant activities of Warfarin.
XimelagatranEtanercept may increase the anticoagulant activities of Ximelagatran.
ZaltoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Zaltoprofen.
ZileutonThe risk or severity of adverse effects can be increased when Etanercept is combined with Zileuton.
Zoledronic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Zoledronic acid.
ZomepiracThe risk or severity of adverse effects can be increased when Etanercept is combined with Zomepirac.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antibody
General Function:
Tumor necrosis factor receptor binding
Specific Function:
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs ...
Gene Name:
TNF
Uniprot ID:
P01375
Molecular Weight:
25644.15 Da
References
  1. Park YC, Burkitt V, Villa AR, Tong L, Wu H: Structural basis for self-association and receptor recognition of human TRAF2. Nature. 1999 Apr 8;398(6727):533-8. [PubMed:10206649 ]
  2. Sandborn WJ, Hanauer SB: Antitumor necrosis factor therapy for inflammatory bowel disease: a review of agents, pharmacology, clinical results, and safety. Inflamm Bowel Dis. 1999 May;5(2):119-33. [PubMed:10338381 ]
  3. Grell M, Zimmermann G, Gottfried E, Chen CM, Grunwald U, Huang DC, Wu Lee YH, Durkop H, Engelmann H, Scheurich P, Wajant H, Strasser A: Induction of cell death by tumour necrosis factor (TNF) receptor 2, CD40 and CD30: a role for TNF-R1 activation by endogenous membrane-anchored TNF. EMBO J. 1999 Jun 1;18(11):3034-43. [PubMed:10357816 ]
  4. Moreland LW: Inhibitors of tumor necrosis factor: new treatment options for rheumatoid arthritis. Cleve Clin J Med. 1999 Jun;66(6):367-74. [PubMed:10375846 ]
  5. Calabrese LH: Rheumatoid arthritis and primary care: the case for early diagnosis and treatment. J Am Osteopath Assoc. 1999 Jun;99(6):313-21. [PubMed:10405518 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Ubiquitin protein ligase binding
Specific Function:
Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by ant...
Gene Name:
TNFRSF1B
Uniprot ID:
P20333
Molecular Weight:
48290.85 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442 ]
  2. Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442 ]
  2. Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Hart SP, Ross JA, Ross K, Haslett C, Dransfield I: Molecular characterization of the surface of apoptotic neutrophils: implications for functional downregulation and recognition by phagocytes. Cell Death Differ. 2000 May;7(5):493-503. [PubMed:10800083 ]
  2. Ranheim EA, Kipps TJ: Tumor necrosis factor-alpha facilitates induction of CD80 (B7-1) and CD54 on human B cells by activated T cells: complex regulation by IL-4, IL-10, and CD40L. Cell Immunol. 1995 Apr 1;161(2):226-35. [PubMed:7535196 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor binding
Specific Function:
Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.
Gene Name:
LTA
Uniprot ID:
P01374
Molecular Weight:
22296.57 Da
References
  1. Johnson CJ, Reilly KM, Murray KM: Etanercept in juvenile rheumatoid arthritis. Ann Pharmacother. 2001 Apr;35(4):464-71. [PubMed:11302411 ]
  2. Pennica D, Lam VT, Mize NK, Weber RF, Lewis M, Fendly BM, Lipari MT, Goeddel DV: Biochemical properties of the 75-kDa tumor necrosis factor receptor. Characterization of ligand binding, internalization, and receptor phosphorylation. J Biol Chem. 1992 Oct 15;267(29):21172-8. [PubMed:1328224 ]
  3. Gudbrandsdottir S, Larsen R, Sorensen LK, Nielsen S, Hansen MB, Svenson M, Bendtzen K, Muller K: TNF and LT binding capacities in the plasma of arthritis patients: effect of etanercept treatment in juvenile idiopathic arthritis. Clin Exp Rheumatol. 2004 Jan-Feb;22(1):118-24. [PubMed:15005015 ]
  4. Buch MH, Conaghan PG, Quinn MA, Bingham SJ, Veale D, Emery P: True infliximab resistance in rheumatoid arthritis: a role for lymphotoxin alpha? Ann Rheum Dis. 2004 Oct;63(10):1344-6. Epub 2004 Mar 19. [PubMed:15033655 ]
  5. Kang CP, Lee KW, Yoo DH, Kang C, Bae SC: The influence of a polymorphism at position -857 of the tumour necrosis factor alpha gene on clinical response to etanercept therapy in rheumatoid arthritis. Rheumatology (Oxford). 2005 Apr;44(4):547-52. Epub 2005 Feb 3. [PubMed:15695296 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Hart SP, Ross JA, Ross K, Haslett C, Dransfield I: Molecular characterization of the surface of apoptotic neutrophils: implications for functional downregulation and recognition by phagocytes. Cell Death Differ. 2000 May;7(5):493-503. [PubMed:10800083 ]
  2. Ozgocmen S, Godekmerdan A, Ozkurt-Zengin F: Acute-phase response, clinical measures and disease activity in ankylosing spondylitis. Joint Bone Spine. 2007 May;74(3):249-53. Epub 2007 Mar 5. [PubMed:17387033 ]
  3. Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442 ]
  4. Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4.
Gene Name:
C1S
Uniprot ID:
P09871
Molecular Weight:
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inhibitor
General Function:
Prostaglandin-endoperoxide synthase activity
Specific Function:
Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Constitutively expressed in some tissues in physiological conditions, such as the endothelium, kidney and brain, and in pathological conditions, such as in cancer. PTGS2 is responsible for production of inflammatory prostaglandins. Up-regulation of PTGS2 is also associated with increased cell adhesion, p...
Gene Name:
PTGS2
Uniprot ID:
P35354
Molecular Weight:
68995.625 Da
References
  1. Bawolak MT, Touzin K, Moreau ME, Desormeaux A, Adam A, Marceau F: Cardiovascular expression of inflammatory signaling molecules, the kinin B1 receptor and COX2, in the rabbit: effects of LPS, anti-inflammatory and anti-hypertensive drugs. Regul Pept. 2008 Feb 7;146(1-3):157-68. Epub 2007 Sep 14. [PubMed:17931716 ]
  2. Genovese T, Mazzon E, Crisafulli C, Di Paola R, Muia C, Bramanti P, Cuzzocrea S: Immunomodulatory effects of etanercept in an experimental model of spinal cord injury. J Pharmacol Exp Ther. 2006 Mar;316(3):1006-16. Epub 2005 Nov 22. [PubMed:16303916 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23