| Identification | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Name | Lutropin alfa | ||||||||||||||
| Accession Number | DB00044 (BIOD00056, BTD00056) | ||||||||||||||
| Type | biotech | ||||||||||||||
| Groups | approved | ||||||||||||||
| Description | Recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues |
||||||||||||||
| Protein structure | |||||||||||||||
| Protein chemical formula | C1014H1609N287O294S27 | ||||||||||||||
| Protein average weight | 23390.3000 | ||||||||||||||
| Sequences |
>AlphaChain APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS >BetaChain (LH) SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYR DVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLF L FASTA |
||||||||||||||
| Synonyms |
|
||||||||||||||
| Brand names |
|
||||||||||||||
| Brand name mixtures | Not Available | ||||||||||||||
| Categories |
|
||||||||||||||
| CAS number | 152923-57-4 | ||||||||||||||
| Taxonomy | |||||||||||||||
| Kingdom | Not Available | ||||||||||||||
| Classes | Not Available | ||||||||||||||
| Substructures | Not Available | ||||||||||||||
| Pharmacology | |||||||||||||||
| Indication | For treatment of female infertility | ||||||||||||||
| Pharmacodynamics | Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone (LH), which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone. | ||||||||||||||
| Mechanism of action | Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes. | ||||||||||||||
| Absorption | Not Available | ||||||||||||||
| Volume of distribution |
|
||||||||||||||
| Protein binding | Not Available | ||||||||||||||
| Metabolism | |||||||||||||||
| Route of elimination | Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally. | ||||||||||||||
| Half life | 4.4 hours (mammalian reticulocytes, in vitro) | ||||||||||||||
| Clearance |
|
||||||||||||||
| Toxicity | Not Available | ||||||||||||||
| Affected organisms |
|
||||||||||||||
| Pathways | Not Available | ||||||||||||||
| Pharmacoeconomics | |||||||||||||||
| Manufacturers |
|
||||||||||||||
| Packagers | |||||||||||||||
| Dosage forms |
|
||||||||||||||
| Prices |
|
||||||||||||||
| Patents |
|
||||||||||||||
| Properties | |||||||||||||||
| State | liquid | ||||||||||||||
| Melting point | 55 oC (Forastieri, H., Ingham, K.C. J. Biol. Chem. 257:7976-7981 (1982)) | ||||||||||||||
| Experimental Properties |
|
||||||||||||||
| References | |||||||||||||||
| Synthesis Reference | Not Available | ||||||||||||||
| General Reference |
|
||||||||||||||
| External Links |
|
||||||||||||||
| ATC Codes |
|
||||||||||||||
| AHFS Codes |
|
||||||||||||||
| PDB Entries | Not Available | ||||||||||||||
| FDA label | show (218 KB) | ||||||||||||||
| MSDS | Not Available | ||||||||||||||
| Interactions | |||||||||||||||
| Drug Interactions |
|
||||||||||||||
| Food Interactions | Not Available | ||||||||||||||
| Targets |
|---|
|
1. Lutropin-choriogonadotropic hormone receptor Pharmacological action: yesActions: agonist Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase Organism class: humanUniProt ID: P22888 ![]() Gene: LHCGR ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
|
| Comments |
|---|
This project is supported by Genome Alberta & Genome Canada, a not-for-profit organization that is leading Canada's national genomics strategy with $600 million in funding from the federal government. This project is also supported in part by GenomeQuest, Inc., an enterprise genomic information company serving the life science community.