Banner
Identification
Name Lutropin alfa
Accession Number DB00044 (BIOD00056, BTD00056)
Type biotech
Groups approved
Description

Recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues

Protein structure
Protein chemical formula C1014H1609N287O294S27
Protein average weight 23390.3000
Sequences
>AlphaChain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

>BetaChain (LH)
SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYR
DVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLF
L

FASTA
Synonyms
  • LH-B
  • LSH- beta
  • LSH-B
  • Luteinizing hormone beta subunit
  • Lutropin beta chain precursor
Brand names
  • Luveris (Serono)
Brand name mixtures Not Available
Categories
  • Fertility Agents
CAS number 152923-57-4
Taxonomy
Kingdom Not Available
Classes Not Available
Substructures Not Available
Pharmacology
Indication For treatment of female infertility
Pharmacodynamics Used to facilitate female conception, lutropin alfa performs the same actions as luteinizing hormone (LH), which is normally produced in the pituitary gland. Lutropin is usually given in combination with follitropin alfa. In females, a LH surge about halfway through the menstrual cycle triggers the onset of ovulation. LH also induces the ovulated follicle to become a corpus luteum, which then secretes progesterone.
Mechanism of action Binds to the luteinizing hormone receptor which then activates adenylate cylcase through G protein mediation. Adenylate cyclase then activates many other pathways leading to steroid hormone production and other follicle maturation processes.
Absorption Not Available
Volume of distribution
  • 10 L
Protein binding Not Available
Metabolism
Route of elimination Total body clearance is approximately 2 to 3 L/h with less than 5 percent of the dose being excreted unchanged renally.
Half life 4.4 hours (mammalian reticulocytes, in vitro)
Clearance
  • 2 – 3 L/h [healthy female following subcutaneous administration]
Toxicity Not Available
Affected organisms
  • Humans and other mammals
Pathways Not Available
Pharmacoeconomics
Manufacturers
  • Emd serono inc
Packagers
Dosage forms
Form Route Strength
Powder, for solution Subcutaneous
Prices
Unit description Cost Unit
Luveris 75 unit vial 38.88 USD vial
Patents
Country Patent Number Approved Expires
United States 5767251 1995-06-16 2015-06-16
Properties
State liquid
Melting point 55 oC (Forastieri, H., Ingham, K.C. J. Biol. Chem. 257:7976-7981 (1982))
Experimental Properties
Property Value Source
hydrophobicity -0.063 PhysProp
isoelectric point 8.44 Various sources
References
Synthesis Reference Not Available
General Reference
  1. Blanchard J: Gastrointestinal absorption. I. Mechanisms. Am J Pharm Sci Support Public Health. 1975 Sep-Oct;147(5):135-46. Pubmed
  2. Louvet JP, Harman SM, Ross GT: Effects of human chorionic gonadotropin, human interstitial cell stimulating hormone and human follicle-stimulating hormone on ovarian weights in estrogen-primed hypophysectomized immature female rats. Endocrinology. 1975 May;96(5):1179-86. Pubmed
  3. Nielsen MS, Barton SD, Hatasaka HH, Stanford JB: Comparison of several one-step home urinary luteinizing hormone detection test kits to OvuQuick. Fertil Steril. 2001 Aug;76(2):384-7. Pubmed
  4. Gibreel A, Bhattacharya S: Recombinant follitropin alfa/lutropin alfa in fertility treatment. Biologics. 2010 Feb 4;4:5-17. Pubmed
External Links
Resource Link
UniProt P01229 Link_out
Genbank X00264 Link_out
PharmGKB PA10306 Link_out
Drug Product Database 2269066 Link_out
Drugs.com http://www.drugs.com/cdi/lutropin-alfa.html Link_out
Wikipedia http://en.wikipedia.org/wiki/Lutropin_alfa Link_out
ATC Codes
  • G03GA07
AHFS Codes
  • 68:18.00
PDB Entries Not Available
FDA label show (218 KB)
MSDS Not Available
Interactions
Drug Interactions
Drug Interaction
Food Interactions Not Available
Targets

1. Lutropin-choriogonadotropic hormone receptor

Pharmacological action: yes
Actions: agonist

Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase

Organism class: human
UniProt ID: P22888 Link_out
Gene: LHCGR Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed
  3. Gibreel A, Bhattacharya S: Recombinant follitropin alfa/lutropin alfa in fertility treatment. Biologics. 2010 Feb 4;4:5-17. Pubmed
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

Comments
Drug created on June 13, 2005 07:24 / Updated on August 04, 2011 22:55

This project is supported by Genome Alberta & Genome Canada, a not-for-profit organization that is leading Canada's national genomics strategy with $600 million in funding from the federal government. This project is also supported in part by GenomeQuest, Inc., an enterprise genomic information company serving the life science community.