You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NamePegademase bovine
Accession NumberDB00061  (BTD00100, BIOD00100)
TypeBiotech
GroupsApproved
Description

Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life.

Protein structureDb00061
Related Articles
Protein chemical formulaC1821H2834N484O552S14
Protein average weight40788.2 Da
Sequences
>DB00061 sequence
MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPE
FLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAI
DLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGY
HTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIF
KSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAE
QCL
Download FASTA Format
Synonyms
Adenosine aminohydrolase
Adenosine deaminase
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Adageninjection, solution250 [iU]/mLintramuscularSigma Tau Pharmaceuticals, Inc.2010-10-18Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNIIHW3H7D91F6
CAS number9026-93-1
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor treatment of adenosine deaminase deficiency
PharmacodynamicsUsed to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function.
Mechanism of actionPegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination.
Related Articles
AbsorptionTime to peak for plasma adenosine deaminase is 2 to 3 days
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeplasma adenosine deaminase elimination half-life is 3 to >6 days
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Sigma tau pharmaceuticals inc
Packagers
Dosage forms
FormRouteStrength
Injection, solutionintramuscular250 [iU]/mL
Prices
Unit descriptionCostUnit
Adagen 250 unit/ml vial4375.0USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
PatentsNot Available
Properties
StateLiquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.428Not Available
isoelectric point5.33Not Available
References
Synthesis Reference

Paul Skonezny, “Process for preparing dideoxyinosine using adenosine deaminase enzyme.” U.S. Patent US20040175804, issued September 09, 2004.

US20040175804
General References

#Lexicomp Online (2014). Pegademase Bovine. Available at:http://online.lexi.com/lco/action/doc/retrieve/docid/patch_f/7443#f_pharmacology-and-pharmacokinetics [Accessed 12 Nov. 2014].

External Links
ATC CodesNot Available
AHFS CodesNot Available
PDB Entries
FDA labelNot Available
MSDSNot Available
Interactions
Drug Interactions
Drug
PegloticaseThe therapeutic efficacy of Pegademase bovine can be decreased when used in combination with Pegloticase.
PentostatinThe therapeutic efficacy of Pentostatin can be decreased when used in combination with Pegademase bovine.
Food InteractionsNot Available

Targets

Kind
Small molecule
Organism
Human
Pharmacological action
yes
Actions
metabolizer
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Van Linden A, Eltzschig HK: Role of pulmonary adenosine during hypoxia: extracellular generation, signaling and metabolism by surface adenosine deaminase/CD26. Expert Opin Biol Ther. 2007 Sep;7(9):1437-47. [PubMed:17727332 ]
  4. Kemeny-Beke A, Jakab A, Zsuga J, Vecsernyes M, Karsai D, Pasztor F, Grenczer M, Szentmiklosi AJ, Berta A, Gesztelyi R: Adenosine deaminase inhibition enhances the inotropic response mediated by A1 adenosine receptor in hyperthyroid guinea pig atrium. Pharmacol Res. 2007 Aug;56(2):124-31. Epub 2007 May 10. [PubMed:17574432 ]
  5. Mohsenin A, Mi T, Xia Y, Kellems RE, Chen JF, Blackburn MR: Genetic removal of the A2A adenosine receptor enhances pulmonary inflammation, mucin production, and angiogenesis in adenosine deaminase-deficient mice. Am J Physiol Lung Cell Mol Physiol. 2007 Sep;293(3):L753-61. Epub 2007 Jun 29. [PubMed:17601796 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
binder
General Function:
Sh3/sh2 adaptor activity
Specific Function:
Adapter protein that provides a critical link between cell surface growth factor receptors and the Ras signaling pathway.Isoform 2 does not bind to phosphorylated epidermal growth factor receptor (EGFR) but inhibits EGF-induced transactivation of a RAS-responsive element. Isoform 2 acts as a dominant negative protein over GRB2 and by suppressing proliferative signals, may trigger active program...
Gene Name:
GRB2
Uniprot ID:
P62993
Molecular Weight:
25206.21 Da
References
  1. Ramos-Morales F, Dominguez A, Rios RM, Barroso SI, Infante C, Schweighoffer F, Tocque B, Pintor-Toro JA, Tortolero M: Adenosine deaminase is a specific partner for the Grb2 isoform Grb3-3. Biochem Biophys Res Commun. 1997 Aug 28;237(3):735-40. [PubMed:9299436 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on March 14, 2016 09:58