| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2008-08-26 17:05:28 |
| Primary Accession Number |
DB01721 |
| Secondary Accession Number |
|
| Name |
Analogue of Indinavir Drug |
| Drug Type |
- Experimental
- Small Molecule
|
| Description |
Not Available |
| Synonyms |
Not Available |
| Brand Names |
Not Available |
| Brand Mixtures |
Not Available |
| Chemical IUPAC Name |
(2S)-4-(1,3-benzodioxol-5-ylmethyl)-N-tert-butyl-1-[(2S,4S,5S)-2-hydroxy-4-[[(1S,2R)-2-hydroxy-2,3-dihydro-1H-inden-1-yl]carbamoyl]-5-phenylhexyl]piperazine-2-carboxamide |
| Chemical Formula |
C39H50N4O6 |
| Chemical Structure |
 |
| CAS Registry Number |
Not Available |
| InChI Identifier |
InChI=1/C39H50N4O6/c1-25(27-10-6-5-7-11-27)31(37(46)40-36-30-13-9-8-12-28(30)19-33(36)45)20-29(44)22-43-17-16-42(23-32(43)38(47)41-39(2,3)4)21-26-14-15-34-35(18-26)49-24-48-34/h5-15,18,25,29,31-33,36,44-45H,16-17,19-24H2,1-4H3,(H,40,46)(H,41,47)/f/h40-41H |
| InChI Key |
MJIRDPUZGGHJMX-IHBONYPBCA |
| KEGG Drug |
Not Available |
| KEGG Compound |
Not Available |
| PubChem Compound |
5496642  |
| PubChem Substance |
7891152  |
| ChEBI ID |
Not Available |
| PharmGKB ID |
Not Available |
| HET ID |
XN2  |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
Not Available |
| RxList Link |
Not Available |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
Not Available |
| FDA Label |
Not Available |
| Material Safety Data Sheet (MSDS) |
Not Available |
| Synthesis Reference |
Not Available |
| Average Molecular Weight |
670.8375 |
| Monoisotopic Molecular Weight |
670.3730 |
| State |
Solid |
| Melting Point |
Not Available |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
2.33e-02 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP |
4.37
Calculated using ALOGPS
|
| Experimental LogS |
Not Available |
| Predicted LogS |
-4.46
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
Not Available |
| pKa/Isoelectric Point |
Not Available |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
1K6V  |
| Experimental PDB File |
Show |
| Experimental PDB Structure |
|
| Isomeric SMILES |
C[C@@H]([C@@H](C[C@@H](O)CN1CCN(C[C@@H]1C(=O)NC(C)(C)C)CC1=CC=C2OCOC2=C1)C(=O)N[C@H]1[C@H](O)CC2=CC=CC=C12)C1=CC=CC=C1 |
| Canonical SMILES |
CC(C(CC(O)CN1CCN(CC1C(=O)NC(C)(C)C)CC1=CC=C2OCOC2=C1)C(=O)NC1C(O)CC2=CC=CC=C12)C1=CC=CC=C1 |
| Drug Category |
Not Available |
| ATC Codes |
Not Available |
| AHFS Codes |
Not Available |
| Indication |
Not Available |
| Pharmacology |
Not Available |
| Mechanism of Action |
Not Available |
| Absorption |
Not Available |
| Toxicity |
Not Available |
| Protein Binding |
Not Available |
| Biotransformation |
Not Available |
| Half Life |
Not Available |
| Dosage Forms |
Not Available
|
| Patient Information |
Not Available |
| Contraindications |
Not Available |
| Interactions |
Not Available |
| Drug Interactions |
Not Available
|
| Food Interactions |
Not Available
|
| Pathways |
Not Available
|
| General References |
Not Available |
| Organisms Affected |
Not Available |
| Targets |
- Gag-Pol polyprotein
|
|
Drug Target 1
[top]
|
| Target 1 ID |
2326 |
| Target 1 Name |
Gag-Pol polyprotein |
| Target 1 Synonyms |
- Pr160Gag-Pol
|
| Target 1 Gene Name |
gag-pol |
| Target 1 Protein Sequence |
>Gag-Pol polyprotein
MGARASVLSAGELDKWEKIRLRPGGKKQYRLKHIVWASRELERFAVDPGLLETSEGCRQI
LGQLQPSLQTGSEELRSLYNTVATLYCVHQKIEVKDTKEALEKIEEEQNKSKKKAQQAAA
DTGNSSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGAT
PQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTT
STLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRF
YKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKA
RVLAEAMSQVTNSATIMMQRGNFRNQRKTVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEG
HQMKDCTERQANFLREDLAFPQGKARKFSSEQTRANSPIRRERQVWRRDNNSLSEAGADR
QGTVSFSFPQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGG
FIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNFPISPIETVPVKLK
PGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRK
LVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIP
SINNETPGTRYQYNVLPQGWKGSPAIFQSSMTTILEPFRKQNPDLVIYQYMDDLYVGSDL
EIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWT
VNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEP
VHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGAHTNDVKQLTEAVQ
KIATESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEP
IIGAETFYVDGAANRETKLGKAGYVTNKGRQKVVSLTDTTNQKTELQAIYLALQDSGLEV
NIVTDSQYALGIIQAQPDRSESELVSQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
AGIRKVLFLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQ
VDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVTTI
HTDNGSNFTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLK
TAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDP
LWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED
|
| Target 1 Number of Residues |
1458 |
| Target 1 Molecular Weight |
161982 |
| Target 1 Theoretical pI |
9.07 |
| Target 1 GO Classification |
|
Function
|
hydrolase activity, acting on ester bonds
nuclease activity
endonuclease activity
endoribonuclease activity
endoribonuclease activity, producing 5'-phosphomonoesters
ribonuclease H activity
hydrolase activity
peptidase activity
endopeptidase activity
aspartic-type endopeptidase activity
structural molecule activity
ion binding
cation binding
transition metal ion binding
zinc ion binding
DNA binding
integrase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
RNA-directed DNA polymerase activity
binding
nucleic acid binding
RNA binding |
|
Process
|
macromolecule metabolism
protein metabolism
cellular protein metabolism
proteolysis
DNA integration
DNA recombination
viral life cycle
physiological process
metabolism
cellular metabolism
nucleobase, nucleoside, nucleotide and nucleic acid metabolism
DNA metabolism
DNA replication
RNA-dependent DNA replication |
|
Component
|
| Not Available |
|
| Target 1 General Function |
Involved in RNA binding |
| Target 1 Specific Function |
Integrase performs the integration of the newly synthesized dsDNA copy of the viral genome into the host chromosome. The integrated DNA is called provirus |
| Target 1 Pathways |
|
| Target 1 Reactions |
- deoxynucleoside triphosphate + DNAn = diphosphate + DNAn+1
|
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
|
| Target 1 Essentiality |
Non-Essential |
| Target 1 GenBank ID Protein |
Not Available |
| Target 1 UniProtKB/Swiss-Prot ID |
P35963  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
POL_HV1Y2  |
| Target 1 PDB ID |
1VRU  |
| Target 1 PDB File |
Show |
| Target 1 3D Structure |
|
| Target 1 Cellular Location |
- Nucleus. Cytoplasm (By similarity). Note=Following virus entry, the nuclear localization signal (NLS
|
| Target 1 Gene Sequence |
Not Available |
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
Not Available |
| Target 1 GenAtlas ID |
Not Available |
| Target 1 HGNC ID |
Not Available |
| Target 1 Chromosome Location |
Not Available |
| Target 1 Locus |
Not Available |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Li Y, Hui H, Burgess CJ, Price RW, Sharp PM, Hahn BH, Shaw GM: Complete nucleotide sequence, genome organization, and biological properties of human immunodeficiency virus type 1 in vivo: evidence for limited defectiveness and complementation. J Virol. 1992 Nov;66(11):6587-600. [PubMed
]
- Cai M, Zheng R, Caffrey M, Craigie R, Clore GM, Gronenborn AM: Solution structure of the N-terminal zinc binding domain of HIV-1 integrase. Nat Struct Biol. 1997 Jul;4(7):567-77. [PubMed
]
- Turner BG, Summers MF: Structural biology of HIV. J Mol Biol. 1999 Jan 8;285(1):1-32. [PubMed
]
|
| Target 1 Drug References |
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|