Beta-lactamase
Details
- Name
- Beta-lactamase
- Synonyms
- 3.5.2.6
- Gene Name
- blaSHV
- Organism
- Escherichia coli
- Amino acid sequence
>lcl|BSEQ0052113|Beta-lactamase GLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQ LLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGARGIVALLGPNNKAERIVVIYLRDT PASMAERNQQ
- Number of residues
- 130
- Molecular Weight
- 14354.285
- Theoretical pI
- Not Available
- GO Classification
- Functionsbeta-lactamase activityProcessesbeta-lactam antibiotic catabolic process / response to antibiotic
- General Function
- Not Available
- Specific Function
- Beta-lactamase activity
- Pfam Domain Function
- Beta-lactamase (PF00144)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID A0A068JFB7 UniProtKB Entry Name A0A068JFB7_ECOLX - General References
- Kar D, Bandyopadhyay S, Bhattacharyya D, Samanta I, Mahanti A, Nanda PK, Mondal B, Dandapat P, Das AK, Dutta TK, Bandyopadhyay S, Singh RK: Molecular and phylogenetic characterization of multidrug resistant extended spectrum beta-lactamase producing Escherichia coli isolated from poultry and cattle in Odisha, India. Infect Genet Evol. 2015 Jan;29:82-90. doi: 10.1016/j.meegid.2014.11.003. Epub 2014 Nov 7. [Article]