Dehydrosqualene synthase
Details
- Name
- Dehydrosqualene synthase
- Synonyms
- 2.5.1.96
- 4,4'-diapophytoene synthase
- DAP synthase
- Diapophytoene synthase
- Gene Name
- crtM
- Organism
- Staphylococcus aureus
- Amino acid sequence
>lcl|BSEQ0017250|Dehydrosqualene synthase MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFL NQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMF ETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENE RIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPI IELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKYHRI
- Number of residues
- 287
- Molecular Weight
- 34312.78
- Theoretical pI
- 6.05
- GO Classification
- Functionstransferase activity, transferring alkyl or aryl (other than methyl) groupsProcessescarotenoid biosynthetic process
- General Function
- Transferase activity, transferring alkyl or aryl (other than methyl) groups
- Specific Function
- Catalyzes the head-to-head condensation of two molecules of farnesyl diphosphate (FPP) into the colorless C(30) carotenoid dehydrosqualene (4,4'-diapophytoene). This is the initial step in the biosynthesis of staphyloxanthin, an orange carotenoid present in most staphylococci strains.
- Pfam Domain Function
- SQS_PSY (PF00494)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID A9JQL9 UniProtKB Entry Name CRTM_STAAU GenBank Protein ID 161788394 GenBank Gene ID AM920687 - General References
- Liu CI, Liu GY, Song Y, Yin F, Hensler ME, Jeng WY, Nizet V, Wang AH, Oldfield E: A cholesterol biosynthesis inhibitor blocks Staphylococcus aureus virulence. Science. 2008 Mar 7;319(5868):1391-4. doi: 10.1126/science.1153018. Epub 2008 Feb 14. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB07420 (1R)-4-(3-phenoxyphenyl)-1-phosphonobutane-1-sulfonic acid experimental unknown Details DB07424 Tripotassium (1R)-4-biphenyl-4-yl-1-phosphonatobutane-1-sulfonate experimental unknown Details DB04695 Farnesyl thiopyrophosphate experimental unknown Details