Ferredoxin--NADP reductase, apicoplast
Details
- Name
- Ferredoxin--NADP reductase, apicoplast
- Synonyms
- 1.18.1.2
- Gene Name
- Not Available
- Organism
- Plasmodium falciparum (isolate 3D7)
- Amino acid sequence
>lcl|BSEQ0051982|Ferredoxin--NADP reductase, apicoplast MKIRFVFILSVLISGVCCISKNVSRRVANRMTAHSRFLFVHDKYKRNKNFKLKNNKEENN FINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYNELDN NPNNQINKDHNIINTTNHTNHNNIALSHIKKQRCARLYSISSSNNMENLSVAIKIHKYEQ TENAPNITNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPY ISFLKKLFAYDKNNLYNRNSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYV FSYKQNSDATSFYVQDEIYKRKTEFLNLFNNYKCELYICGHKSIRYKVMDILKSHDQFDE KKKKRVHVEVY
- Number of residues
- 371
- Molecular Weight
- 43778.59
- Theoretical pI
- Not Available
- GO Classification
- Functionselectron transfer activity / FAD binding / ferredoxin-NAD(P) reductase activity / ferredoxin-NADP+ reductase activity / identical protein bindingProcessesoxidation-reduction processComponentsapicoplast
- General Function
- Not Available
- Specific Function
- Electron transfer activity
- Pfam Domain Function
- NAD_binding_1 (PF00175)
- Transmembrane Regions
- Not Available
- Cellular Location
- Plastid
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID C6KT68 UniProtKB Entry Name FENR_PLAF7 - General References
- Gardner MJ, Hall N, Fung E, White O, Berriman M, Hyman RW, Carlton JM, Pain A, Nelson KE, Bowman S, Paulsen IT, James K, Eisen JA, Rutherford K, Salzberg SL, Craig A, Kyes S, Chan MS, Nene V, Shallom SJ, Suh B, Peterson J, Angiuoli S, Pertea M, Allen J, Selengut J, Haft D, Mather MW, Vaidya AB, Martin DM, Fairlamb AH, Fraunholz MJ, Roos DS, Ralph SA, McFadden GI, Cummings LM, Subramanian GM, Mungall C, Venter JC, Carucci DJ, Hoffman SL, Newbold C, Davis RW, Fraser CM, Barrell B: Genome sequence of the human malaria parasite Plasmodium falciparum. Nature. 2002 Oct 3;419(6906):498-511. [Article]
- Hall N, Pain A, Berriman M, Churcher C, Harris B, Harris D, Mungall K, Bowman S, Atkin R, Baker S, Barron A, Brooks K, Buckee CO, Burrows C, Cherevach I, Chillingworth C, Chillingworth T, Christodoulou Z, Clark L, Clark R, Corton C, Cronin A, Davies R, Davis P, Dear P, Dearden F, Doggett J, Feltwell T, Goble A, Goodhead I, Gwilliam R, Hamlin N, Hance Z, Harper D, Hauser H, Hornsby T, Holroyd S, Horrocks P, Humphray S, Jagels K, James KD, Johnson D, Kerhornou A, Knights A, Konfortov B, Kyes S, Larke N, Lawson D, Lennard N, Line A, Maddison M, McLean J, Mooney P, Moule S, Murphy L, Oliver K, Ormond D, Price C, Quail MA, Rabbinowitsch E, Rajandream MA, Rutter S, Rutherford KM, Sanders M, Simmonds M, Seeger K, Sharp S, Smith R, Squares R, Squares S, Stevens K, Taylor K, Tivey A, Unwin L, Whitehead S, Woodward J, Sulston JE, Craig A, Newbold C, Barrell BG: Sequence of Plasmodium falciparum chromosomes 1, 3-9 and 13. Nature. 2002 Oct 3;419(6906):527-31. [Article]
- Kimata-Ariga Y, Kurisu G, Kusunoki M, Aoki S, Sato D, Kobayashi T, Kita K, Horii T, Hase T: Cloning and characterization of ferredoxin and ferredoxin-NADP+ reductase from human malaria parasite. J Biochem. 2007 Mar;141(3):421-8. doi: 10.1093/jb/mvm046. Epub 2007 Jan 23. [Article]
- Milani M, Balconi E, Aliverti A, Mastrangelo E, Seeber F, Bolognesi M, Zanetti G: Ferredoxin-NADP+ reductase from Plasmodium falciparum undergoes NADP+-dependent dimerization and inactivation: functional and crystallographic analysis. J Mol Biol. 2007 Mar 23;367(2):501-13. doi: 10.1016/j.jmb.2007.01.005. Epub 2007 Jan 9. [Article]
- Crobu D, Canevari G, Milani M, Pandini V, Vanoni MA, Bolognesi M, Zanetti G, Aliverti A: Plasmodium falciparum ferredoxin-NADP+ reductase His286 plays a dual role in NADP(H) binding and catalysis. Biochemistry. 2009 Oct 13;48(40):9525-33. doi: 10.1021/bi9013209. [Article]