Cytochrome c3
Details
- Name
- Cytochrome c3
- Synonyms
- Cytochrome c551.5
- Cytochrome c7
- Gene Name
- cyd
- Organism
- Desulfuromonas acetoxidans
- Amino acid sequence
>lcl|BSEQ0016972|Cytochrome c3 ADVVTYENKKGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPT KCGGCHIK
- Number of residues
- 68
- Molecular Weight
- 7262.195
- Theoretical pI
- 8.62
- GO Classification
- Functionselectron carrier activity / heme binding / metal ion bindingProcessesanaerobic respiration
- General Function
- Metal ion binding
- Specific Function
- Participates in sulfate respiration coupled with phosphorylation by transferring electrons from the enzyme dehydrogenase to ferredoxin.
- Pfam Domain Function
- Cytochrom_CIII (PF02085)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0005967|207 bp GCTGATGTGGTGACGTATGAGAATAAGAAGGGCAACGTTACCTTTGACCACAAAGCTCAT GCCGAGAAACTGGGCTGTGACGCATGTCACGAAGGTACTCCGGCAAAGATTGCTATCGAC AAGAAGTCTGCTCACAAAGACGCGTGCAAAACCTGCCACAAAAGCAACAATGGCCCCACC AAATGTGGCGGCTGCCATATCAAATAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00137 UniProtKB Entry Name CYC3_DESAC GenBank Gene ID AF005234 - General References
- Ambler RP: The amino acid sequence of cytochrome c-551.5 (Cytochrome c(7)) from the green photosynthetic bacterium Chloropseudomonas ethylica. FEBS Lett. 1971 Nov 1;18(2):351-353. [Article]
- Aubert C, Lojou E, Bianco P, Rousset M, Durand MC, Bruschi M, Dolla A: The Desulfuromonas acetoxidans triheme cytochrome c7 produced in Desulfovibrio desulfuricans retains its metal reductase activity. Appl Environ Microbiol. 1998 Apr;64(4):1308-12. [Article]
- Turner DL, Costa HS, Coutinho IB, Legall J, Xavier AV: Assignment of the ligand geometry and redox potentials of the trihaem ferricytochrome c3 from Desulfuromonas acetoxidans. Eur J Biochem. 1997 Jan 15;243(1-2):474-81. [Article]
- Assfalg M, Bertini I, Bruschi M, Michel C, Turano P: The metal reductase activity of some multiheme cytochromes c: NMR structural characterization of the reduction of chromium(VI) to chromium(III) by cytochrome c(7). Proc Natl Acad Sci U S A. 2002 Jul 23;99(15):9750-4. Epub 2002 Jul 15. [Article]
- Czjzek M, Arnoux P, Haser R, Shepard W: Structure of cytochrome c7 from Desulfuromonas acetoxidans at 1.9 A resolution. Acta Crystallogr D Biol Crystallogr. 2001 May;57(Pt 5):670-8. Epub 2001 Apr 24. [Article]
- Banci L, Bertini I, Bruschi M, Sompornpisut P, Turano P: NMR characterization and solution structure determination of the oxidized cytochrome c7 from Desulfuromonas acetoxidans. Proc Natl Acad Sci U S A. 1996 Dec 10;93(25):14396-400. [Article]
- Assfalg M, Banci L, Bertini I, Bruschi M, Turano P: 800 MHz 1H NMR solution structure refinement of oxidized cytochrome c7 from Desulfuromonas acetoxidans. Eur J Biochem. 1998 Sep 1;256(2):261-70. [Article]
- Assfalg M, Banci L, Bertini I, Bruschi M, Giudici-Orticoni MT, Turano P: A proton-NMR investigation of the fully reduced cytochrome c7 from Desulfuromonas acetoxidans. Comparison between the reduced and the oxidized forms. Eur J Biochem. 1999 Dec;266(2):634-43. [Article]
- Assfalg M, Bertini I, Turano P, Bruschi M, Durand MC, Giudici-Orticoni MT, Dolla A: A quick solution structure determination of the fully oxidized double mutant K9-10A cytochrome c7 from Desulfuromonas acetoxidans and mechanistic implications. J Biomol NMR. 2002 Feb;22(2):107-22. [Article]