Ig kappa chain V-I region Bi
Details
- Name
- Ig kappa chain V-I region Bi
- Synonyms
- Not Available
- Gene Name
- Not Available
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0012899|Ig kappa chain V-I region Bi DIQMTQSPSPLSASVGDSVTITCQASQDIRNSLIWYQQKPGKAPKFLIYDAENLEIGVPS RFRGSGSGTDFALSISSLQPEDFATYYCQQYYNLPYTFGQGTKLEIKR
- Number of residues
- 108
- Molecular Weight
- 12026.335
- Theoretical pI
- 4.97
- GO Classification
- Functionsantigen bindingProcessescomplement activation / complement activation, classical pathway / Fc-epsilon receptor signaling pathway / Fc-gamma receptor signaling pathway involved in phagocytosis / immune response / innate immune response / receptor-mediated endocytosis / regulation of immune responseComponentsextracellular region / plasma membrane
- General Function
- Antigen binding
- Specific Function
- Not Available
- Pfam Domain Function
- V-set (PF07686)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P01593 UniProtKB Entry Name KV103_HUMAN - General References
- Braun M, Leibold W, Barnikol HU, Hilschmann N: [Principle of antibody structure. The primary structure of a monoclonal kappa I-type immunoglobulin L-chain (Bence Jones protein Bi). 3. The complete aminno acid sequence and the genetic significance of the variability principles for the mechanism of antibody formation]. Hoppe Seylers Z Physiol Chem. 1972 Aug;353(8):1284-306. [Article]