Ig heavy chain V-III region 23
Details
- Name
- Ig heavy chain V-III region 23
- Synonyms
- Ig heavy chain V-III region VH26
- Immunoglobulin heavy variable 3-23
- Gene Name
- IGHV3-23
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0020749|Ig heavy chain V-III region 23 MEFGLSWLFLVAILKGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAP GKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
- Number of residues
- 117
- Molecular Weight
- 12582.21
- Theoretical pI
- 8.46
- GO Classification
- Functionsantigen binding / immunoglobulin receptor bindingProcessesB cell receptor signaling pathway / complement activation / complement activation, classical pathway / defense response to bacterium / Fc-epsilon receptor signaling pathway / Fc-gamma receptor signaling pathway involved in phagocytosis / immune response / innate immune response / phagocytosis, engulfment / phagocytosis, recognition / positive regulation of B cell activation / receptor-mediated endocytosis / regulation of immune responseComponentsblood microparticle / external side of plasma membrane / extracellular exosome / extracellular region / immunoglobulin complex, circulating / plasma membrane
- General Function
- Immunoglobulin receptor binding
- Specific Function
- Not Available
- Pfam Domain Function
- V-set (PF07686)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P01764 UniProtKB Entry Name HV303_HUMAN GenBank Protein ID 553422 GenBank Gene ID M35415 HGNC ID HGNC:5588 - General References
- Matthyssens G, Rabbitts TH: Structure and multiplicity of genes for the human immunoglobulin heavy chain variable region. Proc Natl Acad Sci U S A. 1980 Nov;77(11):6561-5. [Article]
- Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [Article]
- Mariette X, Tsapis A, Brouet JC: Nucleotidic sequence analysis of the variable domains of four human monoclonal IgM with an antibody activity to myelin-associated glycoprotein. Eur J Immunol. 1993 Apr;23(4):846-51. [Article]
- Toyonaga B, Yoshikai Y, Vadasz V, Chin B, Mak TW: Organization and sequences of the diversity, joining, and constant region genes of the human T-cell receptor beta chain. Proc Natl Acad Sci U S A. 1985 Dec;82(24):8624-8. [Article]