Guanyl-specific ribonuclease Sa
Details
- Name
- Guanyl-specific ribonuclease Sa
- Synonyms
- 3.1.27.3
- RNase Sa
- Gene Name
- rnaSA
- Organism
- Streptomyces aureofaciens
- Amino acid sequence
>lcl|BSEQ0010956|Guanyl-specific ribonuclease Sa DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITP GARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
- Number of residues
- 96
- Molecular Weight
- 10575.465
- Theoretical pI
- 4.16
- GO Classification
- Functionsendoribonuclease activity / ribonuclease T1 activity / RNA bindingComponentsextracellular region
- General Function
- Rna binding
- Specific Function
- Not Available
- Pfam Domain Function
- Ribonuclease (PF00545)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P05798 UniProtKB Entry Name RNSA_STRAU - General References
- Shlyapnikov SV, Both V, Kulikov VA, Dementiev AA, Sevcik J, Zelinka J: Amino acid sequence determination of guanyl-specific ribonuclease Sa from Streptomyces aureofaciens. FEBS Lett. 1986 Dec 15;209(2):335-9. [Article]
- Shliapnikov SV, Both V, Kulikov VA, Dement'ev AA, Zelinka J: [Extracellular guanyl-specific ribonuclease Sa from the actinomycete Streptomyces aureofaciens. Primary structure and homology with ribonucleases from bacteria and fungi]. Bioorg Khim. 1987 Jun;13(6):760-72. [Article]
- Sevcik J, Dodson EJ, Dodson GG: Determination and restrained least-squares refinement of the structures of ribonuclease Sa and its complex with 3'-guanylic acid at 1.8 A resolution. Acta Crystallogr B. 1991 Apr 1;47 ( Pt 2):240-53. [Article]
- Sevcik J, Zegers I, Wyns L, Dauter Z, Wilson KS: Complex of ribonuclease Sa with a cyclic nucleotide and a proposed model for the reaction intermediate. Eur J Biochem. 1993 Aug 15;216(1):301-5. [Article]
- Sevcik J, Hill CP, Dauter Z, Wilson KS: Complex of ribonuclease from Streptomyces aureofaciens with 2'-GMP at 1.7 A resolution. Acta Crystallogr D Biol Crystallogr. 1993 Mar 1;49(Pt 2):257-71. [Article]
- Sevcik J, Dauter Z, Lamzin VS, Wilson KS: Ribonuclease from Streptomyces aureofaciens at atomic resolution. Acta Crystallogr D Biol Crystallogr. 1996 Mar 1;52(Pt 2):327-44. [Article]
- Sevcik J, Urbanikova L, Dauter Z, Wilson KS: Recognition of RNase Sa by the inhibitor barstar: structure of the complex at 1.7 A resolution. Acta Crystallogr D Biol Crystallogr. 1998 Sep 1;54(Pt 5):954-63. [Article]
- Hebert EJ, Giletto A, Sevcik J, Urbanikova L, Wilson KS, Dauter Z, Pace CN: Contribution of a conserved asparagine to the conformational stability of ribonucleases Sa, Ba, and T1. Biochemistry. 1998 Nov 17;37(46):16192-200. [Article]
- Laurents D, Perez-Canadillas JM, Santoro J, Rico M, Schell D, Pace CN, Bruix M: Solution structure and dynamics of ribonuclease Sa. Proteins. 2001 Aug 15;44(3):200-11. [Article]