GTP-binding protein RHO1
Details
- Name
- GTP-binding protein RHO1
- Synonyms
- Rho-type GTPase 1
- Gene Name
- RHO1
- Organism
- Baker's yeast
- Amino acid sequence
>lcl|BSEQ0052583|GTP-binding protein RHO1 MSQQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVEL ALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILV GCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAAT RASLMGKSKTNGKAKKNTTEKKKKKCVLL
- Number of residues
- 209
- Molecular Weight
- 23152.32
- Theoretical pI
- Not Available
- GO Classification
- FunctionsG-protein beta-subunit binding / GTP binding / GTPase activity / protein kinase bindingProcessesactin cytoskeleton organization / actin cytoskeleton reorganization / actin filament organization / budding cell bud growth / cellular bud neck septin ring organization / cortical cytoskeleton organization / establishment or maintenance of cell polarity / positive regulation of endocytosis / positive regulation of mitotic actomyosin contractile ring assembly / positive regulation of protein kinase C signaling / regulation of actin cytoskeleton organization / regulation of cell shape / regulation of cell size / regulation of cell wall (1->3)-beta-D-glucan biosynthetic process / regulation of exocyst localization / regulation of fungal-type cell wall organization / regulation of protein localization / regulation of secondary cell septum biogenesis / regulation of vacuole fusion, non-autophagic / small GTPase mediated signal transductionComponents1,3-beta-D-glucan synthase complex / cell cortex / cell periphery / cell projection / cellular bud / cellular bud neck / cellular bud tip / cytoplasmic vesicle / cytoskeleton / endoplasmic reticulum / endosome membrane / fungal-type vacuole membrane / Golgi apparatus / incipient cellular bud site / intracellular membrane-bounded organelle / mating projection tip / mitochondrial outer membrane / mitochondrion / peroxisomal membrane / peroxisome / plasma membrane
- General Function
- Acts as a central regulator in the cell wall integrity signaling pathway, which is regulated by the cell cycle and in response to various types of cell wall stress. Integrates signals from different cell surface sensors, and activates a set of effectors, regulating processes including beta-glucan synthesis at the site of wall remodeling, gene expression related to cell wall biogenesis, organization of the actin cytoskeleton, and protein- and secretory vesicle-targeting to the growth site. Activates the protein kinase C (PKC1) MAP kinase cascade, the beta-1,3-glucan synthase (FKS1), the formin BNI1, the exocyst component SEC3 and the transcription factor SKN7.
- Specific Function
- G-protein beta-subunit binding
- Pfam Domain Function
- Ras (PF00071)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0052584|GTP-binding protein RHO1 (RHO1) ATGTCACAACAAGTTGGTAACAGTATCAGAAGAAAGCTGGTAATCGTTGGTGATGGTGCC TGTGGTAAGACATGTTTATTAATCGTCTTTTCCAAGGGCCAATTTCCAGAAGTCTACGTA CCAACTGTCTTTGAAAACTATGTAGCAGATGTTGAAGTTGATGGGCGTCGTGTAGAGCTA GCGCTATGGGATACCGCTGGTCAAGAAGATTATGATAGACTAAGACCATTGTCATACCCA GACTCCAATGTCGTATTAATTTGTTTCTCTATCGATCTTCCAGATTCTTTAGAGAATGTA CAAGAAAAATGGATTGCCGAAGTATTACATTTCTGTCAAGGTGTGCCAATTATTCTTGTT GGTTGTAAAGTGGATTTGAGAAACGACCCACAAACCATTGAACAATTAAGACAAGAAGGT CAACAACCCGTTACATCACAGGAGGGACAATCTGTAGCAGACCAGATTGGCGCAACCGGA TACTACGAATGTTCGGCCAAGACTGGTTATGGTGTCAGAGAAGTGTTTGAGGCCGCCACT AGAGCTTCATTGATGGGTAAATCTAAAACGAATGGTAAAGCTAAGAAGAACACTACTGAA AAGAAGAAGAAGAAGTGTGTCTTGTTATAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P06780 UniProtKB Entry Name RHO1_YEAST - General References
- Madaule P, Axel R, Myers AM: Characterization of two members of the rho gene family from the yeast Saccharomyces cerevisiae. Proc Natl Acad Sci U S A. 1987 Feb;84(3):779-83. doi: 10.1073/pnas.84.3.779. [Article]
- Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al.: The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI. Nature. 1997 May 29;387(6632 Suppl):103-5. [Article]
- Engel SR, Dietrich FS, Fisk DG, Binkley G, Balakrishnan R, Costanzo MC, Dwight SS, Hitz BC, Karra K, Nash RS, Weng S, Wong ED, Lloyd P, Skrzypek MS, Miyasato SR, Simison M, Cherry JM: The reference genome sequence of Saccharomyces cerevisiae: then and now. G3 (Bethesda). 2014 Mar 20;4(3):389-98. doi: 10.1534/g3.113.008995. [Article]
- Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J: Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Genome Res. 2007 Apr;17(4):536-43. Epub 2007 Feb 23. [Article]
- Myers AM, Crivellone MD, Tzagoloff A: Assembly of the mitochondrial membrane system. MRP1 and MRP2, two yeast nuclear genes coding for mitochondrial ribosomal proteins. J Biol Chem. 1987 Mar 5;262(7):3388-97. [Article]
- Yamochi W, Tanaka K, Nonaka H, Maeda A, Musha T, Takai Y: Growth site localization of Rho1 small GTP-binding protein and its involvement in bud formation in Saccharomyces cerevisiae. J Cell Biol. 1994 Jun;125(5):1077-93. doi: 10.1083/jcb.125.5.1077. [Article]
- Wang T, Bretscher A: The rho-GAP encoded by BEM2 regulates cytoskeletal structure in budding yeast. Mol Biol Cell. 1995 Aug;6(8):1011-24. doi: 10.1091/mbc.6.8.1011. [Article]
- Ozaki K, Tanaka K, Imamura H, Hihara T, Kameyama T, Nonaka H, Hirano H, Matsuura Y, Takai Y: Rom1p and Rom2p are GDP/GTP exchange proteins (GEPs) for the Rho1p small GTP binding protein in Saccharomyces cerevisiae. EMBO J. 1996 May 1;15(9):2196-207. [Article]
- Nonaka H, Tanaka K, Hirano H, Fujiwara T, Kohno H, Umikawa M, Mino A, Takai Y: A downstream target of RHO1 small GTP-binding protein is PKC1, a homolog of protein kinase C, which leads to activation of the MAP kinase cascade in Saccharomyces cerevisiae. EMBO J. 1995 Dec 1;14(23):5931-8. [Article]
- Kohno H, Tanaka K, Mino A, Umikawa M, Imamura H, Fujiwara T, Fujita Y, Hotta K, Qadota H, Watanabe T, Ohya Y, Takai Y: Bni1p implicated in cytoskeletal control is a putative target of Rho1p small GTP binding protein in Saccharomyces cerevisiae. EMBO J. 1996 Nov 15;15(22):6060-8. [Article]
- Kamada Y, Qadota H, Python CP, Anraku Y, Ohya Y, Levin DE: Activation of yeast protein kinase C by Rho1 GTPase. J Biol Chem. 1996 Apr 19;271(16):9193-6. doi: 10.1074/jbc.271.16.9193. [Article]
- Drgonova J, Drgon T, Tanaka K, Kollar R, Chen GC, Ford RA, Chan CS, Takai Y, Cabib E: Rho1p, a yeast protein at the interface between cell polarization and morphogenesis. Science. 1996 Apr 12;272(5259):277-9. doi: 10.1126/science.272.5259.277. [Article]
- Qadota H, Python CP, Inoue SB, Arisawa M, Anraku Y, Zheng Y, Watanabe T, Levin DE, Ohya Y: Identification of yeast Rho1p GTPase as a regulatory subunit of 1,3-beta-glucan synthase. Science. 1996 Apr 12;272(5259):279-81. doi: 10.1126/science.272.5259.279. [Article]
- Schmidt A, Bickle M, Beck T, Hall MN: The yeast phosphatidylinositol kinase homolog TOR2 activates RHO1 and RHO2 via the exchange factor ROM2. Cell. 1997 Feb 21;88(4):531-42. doi: 10.1016/s0092-8674(00)81893-0. [Article]
- Koch G, Tanaka K, Masuda T, Yamochi W, Nonaka H, Takai Y: Association of the Rho family small GTP-binding proteins with Rho GDP dissociation inhibitor (Rho GDI) in Saccharomyces cerevisiae. Oncogene. 1997 Jul 24;15(4):417-22. doi: 10.1038/sj.onc.1201194. [Article]
- Alberts AS, Bouquin N, Johnston LH, Treisman R: Analysis of RhoA-binding proteins reveals an interaction domain conserved in heterotrimeric G protein beta subunits and the yeast response regulator protein Skn7. J Biol Chem. 1998 Apr 10;273(15):8616-22. doi: 10.1074/jbc.273.15.8616. [Article]
- Roumanie O, Weinachter C, Larrieu I, Crouzet M, Doignon F: Functional characterization of the Bag7, Lrg1 and Rgd2 RhoGAP proteins from Saccharomyces cerevisiae. FEBS Lett. 2001 Oct 5;506(2):149-56. doi: 10.1016/s0014-5793(01)02906-4. [Article]
- Saka A, Abe M, Okano H, Minemura M, Qadota H, Utsugi T, Mino A, Tanaka K, Takai Y, Ohya Y: Complementing yeast rho1 mutation groups with distinct functional defects. J Biol Chem. 2001 Dec 7;276(49):46165-71. doi: 10.1074/jbc.M103805200. Epub 2001 Sep 26. [Article]
- Guo W, Tamanoi F, Novick P: Spatial regulation of the exocyst complex by Rho1 GTPase. Nat Cell Biol. 2001 Apr;3(4):353-60. doi: 10.1038/35070029. [Article]
- Watanabe D, Abe M, Ohya Y: Yeast Lrg1p acts as a specialized RhoGAP regulating 1,3-beta-glucan synthesis. Yeast. 2001 Jul;18(10):943-51. doi: 10.1002/yea.742. [Article]
- Tolliday N, VerPlank L, Li R: Rho1 directs formin-mediated actin ring assembly during budding yeast cytokinesis. Curr Biol. 2002 Oct 29;12(21):1864-70. doi: 10.1016/s0960-9822(02)01238-1. [Article]
- Schmelzle T, Helliwell SB, Hall MN: Yeast protein kinases and the RHO1 exchange factor TUS1 are novel components of the cell integrity pathway in yeast. Mol Cell Biol. 2002 Mar;22(5):1329-39. doi: 10.1128/MCB.22.5.1329-1339.2002. [Article]
- Schmidt A, Schmelzle T, Hall MN: The RHO1-GAPs SAC7, BEM2 and BAG7 control distinct RHO1 functions in Saccharomyces cerevisiae. Mol Microbiol. 2002 Sep;45(5):1433-41. doi: 10.1046/j.1365-2958.2002.03110.x. [Article]
- Dong Y, Pruyne D, Bretscher A: Formin-dependent actin assembly is regulated by distinct modes of Rho signaling in yeast. J Cell Biol. 2003 Jun 23;161(6):1081-92. doi: 10.1083/jcb.200212040. Epub 2003 Jun 16. [Article]
- Bar EE, Ellicott AT, Stone DE: Gbetagamma recruits Rho1 to the site of polarized growth during mating in budding yeast. J Biol Chem. 2003 Jun 13;278(24):21798-804. doi: 10.1074/jbc.M212636200. Epub 2003 Mar 26. [Article]
- Valdivia RH, Schekman R: The yeasts Rho1p and Pkc1p regulate the transport of chitin synthase III (Chs3p) from internal stores to the plasma membrane. Proc Natl Acad Sci U S A. 2003 Sep 2;100(18):10287-92. doi: 10.1073/pnas.1834246100. Epub 2003 Aug 19. [Article]
- Fitch PG, Gammie AE, Lee DJ, de Candal VB, Rose MD: Lrg1p Is a Rho1 GTPase-activating protein required for efficient cell fusion in yeast. Genetics. 2004 Oct;168(2):733-46. doi: 10.1534/genetics.104.028027. [Article]
- Marelli M, Smith JJ, Jung S, Yi E, Nesvizhskii AI, Christmas RH, Saleem RA, Tam YY, Fagarasanu A, Goodlett DR, Aebersold R, Rachubinski RA, Aitchison JD: Quantitative mass spectrometry reveals a role for the GTPase Rho1p in actin organization on the peroxisome membrane. J Cell Biol. 2004 Dec 20;167(6):1099-112. doi: 10.1083/jcb.200404119. Epub 2004 Dec 13. [Article]
- Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. [Article]