Protein RecA
Details
- Name
- Protein RecA
- Synonyms
- lexB
- recH
- Recombinase A
- rnmB
- tif
- umuB
- zab
- Gene Name
- recA
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0052762|Protein RecA MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMG RIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQP DTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLA GNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVG SETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIG QGKANATAWLKDNPETAKEIEKKVRELLLSNPNSTPDFSVDDSEGVAETNEDF
- Number of residues
- 353
- Molecular Weight
- 37973.03
- Theoretical pI
- Not Available
- GO Classification
- FunctionsATP binding / ATPase, acting on DNA / damaged DNA binding / single-stranded DNA bindingProcessescell motility / cellular response to DNA damage stimulus / DNA recombination / DNA repair / response to ionizing radiation / response to radiation / SOS responseComponentscytoplasm
- General Function
- Required for homologous recombination and the bypass of mutagenic DNA lesions by the SOS response. Catalyzes ATP-driven homologous pairing and strand exchange of DNA molecules necessary for DNA recombinational repair. Catalyzes the hydrolysis of ATP in the presence of single-stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs. The SOS response controls an apoptotic-like death (ALD) induced (in the absence of the mazE-mazF toxin-antitoxin module) in response to DNA damaging agents that is mediated by RecA and LexA (PubMed:22412352).
- Specific Function
- Atp binding
- Pfam Domain Function
- RecA (PF00154)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0052763|Protein RecA (recA) ATGGCTATCGACGAAAACAAACAGAAAGCGTTGGCGGCAGCACTGGGCCAGATTGAGAAA CAATTTGGTAAAGGCTCCATCATGCGCCTGGGTGAAGACCGTTCCATGGATGTGGAAACC ATCTCTACCGGTTCGCTTTCACTGGATATCGCGCTTGGGGCAGGTGGTCTGCCGATGGGC CGTATCGTCGAAATCTACGGACCGGAATCTTCCGGTAAAACCACGCTGACGCTGCAGGTG ATCGCCGCAGCGCAGCGTGAAGGTAAAACCTGTGCGTTTATCGATGCTGAACACGCGCTG GACCCAATCTACGCACGTAAACTGGGCGTCGATATCGACAACCTGCTGTGCTCCCAGCCG GACACCGGCGAGCAGGCACTGGAAATCTGTGACGCCCTGGCGCGTTCTGGCGCAGTAGAC GTTATCGTCGTTGACTCCGTGGCGGCACTGACGCCGAAAGCGGAAATCGAAGGCGAAATC GGCGACTCTCACATGGGCCTTGCGGCACGTATGATGAGCCAGGCGATGCGTAAGCTGGCG GGTAACCTGAAGCAGTCCAACACGCTGCTGATCTTCATCAACCAGATCCGTATGAAAATT GGTGTGATGTTCGGTAACCCGGAAACCACTACCGGTGGTAACGCGCTGAAATTCTACGCC TCTGTTCGTCTCGACATCCGTCGTATCGGCGCGGTGAAAGAGGGCGAAAACGTGGTGGGT AGCGAAACCCGCGTGAAAGTGGTGAAGAACAAAATCGCTGCGCCGTTTAAACAGGCTGAA TTCCAGATCCTCTACGGCGAAGGTATCAACTTCTACGGCGAACTGGTTGACCTGGGCGTA AAAGAGAAGCTGATCGAGAAAGCAGGCGCGTGGTACAGCTACAAAGGTGAGAAGATCGGT CAGGGTAAAGCGAATGCGACTGCCTGGCTGAAAGATAACCCGGAAACCGCGAAAGAGATC GAGAAGAAAGTACGTGAGTTGCTGCTGAGCAACCCGAACTCAACGCCGGATTTCTCTGTA GATGATAGCGAAGGCGTAGCAGAAACTAACGAAGATTTTTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A7G6 UniProtKB Entry Name RECA_ECOLI - General References
- Horii T, Ogawa T, Ogawa H: Organization of the recA gene of Escherichia coli. Proc Natl Acad Sci U S A. 1980 Jan;77(1):313-7. doi: 10.1073/pnas.77.1.313. [Article]
- Sancar A, Stachelek C, Konigsberg W, Rupp WD: Sequences of the recA gene and protein. Proc Natl Acad Sci U S A. 1980 May;77(5):2611-5. doi: 10.1073/pnas.77.5.2611. [Article]
- Zhao XJ, McEntee K: DNA sequence analysis of the recA genes from Proteus vulgaris, Erwinia carotovora, Shigella flexneri and Escherichia coli B/r. Mol Gen Genet. 1990 Jul;222(2-3):369-76. [Article]
- Yamamoto Y, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kimura S, Kitagawa M, Makino K, Miki T, Mitsuhashi N, Mizobuchi K, Mori H, Nakade S, Nakamura Y, Nashimoto H, Oshima T, Oyama S, Saito N, Sampei G, Satoh Y, Sivasundaram S, Tagami H, Horiuchi T, et al.: Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features. DNA Res. 1997 Apr 28;4(2):91-113. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Morimatsu K, Horii T: The DNA-binding site of the RecA protein. Photochemical cross-linking of Tyr103 to single-stranded DNA. Eur J Biochem. 1995 Mar 15;228(3):772-8. [Article]
- Gardner RV, Voloshin ON, Camerini-Otero RD: The identification of the single-stranded DNA-binding domain of the Escherichia coli RecA protein. Eur J Biochem. 1995 Oct 15;233(2):419-25. doi: 10.1111/j.1432-1033.1995.419_2.x. [Article]
- VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [Article]
- Dixon DA, Kowalczykowski SC: Role of the Escherichia coli recombination hotspot, chi, in RecABCD-dependent homologous pairing. J Biol Chem. 1995 Jul 7;270(27):16360-70. doi: 10.1074/jbc.270.27.16360. [Article]
- Jones PG, Inouye M: RbfA, a 30S ribosomal binding factor, is a cold-shock protein whose absence triggers the cold-shock response. Mol Microbiol. 1996 Sep;21(6):1207-18. doi: 10.1111/j.1365-2958.1996.tb02582.x. [Article]
- Anderson DG, Kowalczykowski SC: The translocating RecBCD enzyme stimulates recombination by directing RecA protein onto ssDNA in a chi-regulated manner. Cell. 1997 Jul 11;90(1):77-86. doi: 10.1016/s0092-8674(00)80315-3. [Article]
- Fernandez De Henestrosa AR, Ogi T, Aoyagi S, Chafin D, Hayes JJ, Ohmori H, Woodgate R: Identification of additional genes belonging to the LexA regulon in Escherichia coli. Mol Microbiol. 2000 Mar;35(6):1560-72. doi: 10.1046/j.1365-2958.2000.01826.x. [Article]
- Spies M, Kowalczykowski SC: The RecA binding locus of RecBCD is a general domain for recruitment of DNA strand exchange proteins. Mol Cell. 2006 Feb 17;21(4):573-80. doi: 10.1016/j.molcel.2006.01.007. [Article]
- Davies BW, Kohanski MA, Simmons LA, Winkler JA, Collins JJ, Walker GC: Hydroxyurea induces hydroxyl radical-mediated cell death in Escherichia coli. Mol Cell. 2009 Dec 11;36(5):845-60. doi: 10.1016/j.molcel.2009.11.024. [Article]
- Erental A, Sharon I, Engelberg-Kulka H: Two programmed cell death systems in Escherichia coli: an apoptotic-like death is inhibited by the mazEF-mediated death pathway. PLoS Biol. 2012;10(3):e1001281. doi: 10.1371/journal.pbio.1001281. Epub 2012 Mar 6. [Article]
- Cooper DL, Lovett ST: Recombinational branch migration by the RadA/Sms paralog of RecA in Escherichia coli. Elife. 2016 Feb 4;5. doi: 10.7554/eLife.10807. [Article]
- Story RM, Weber IT, Steitz TA: The structure of the E. coli recA protein monomer and polymer. Nature. 1992 Jan 23;355(6358):318-25. doi: 10.1038/355318a0. [Article]
- Story RM, Steitz TA: Structure of the recA protein-ADP complex. Nature. 1992 Jan 23;355(6358):374-6. doi: 10.1038/355374a0. [Article]
- Yu X, Egelman EH: The RecA hexamer is a structural homologue of ring helicases. Nat Struct Biol. 1997 Feb;4(2):101-4. doi: 10.1038/nsb0297-101. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details