2-iminobutanoate/2-iminopropanoate deaminase
Details
- Name
- 2-iminobutanoate/2-iminopropanoate deaminase
- Synonyms
- 3.5.99.10
- Enamine/imine deaminase
- yjgF
- Gene Name
- ridA
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0004074|2-iminobutanoate/2-iminopropanoate deaminase MSKTIATENAPAAIGPYVQGVDLGNMIITSGQIPVNPKTGEVPADVAAQARQSLDNVKAI VEAAGLKVGDIVKTTVFVKDLNDFATVNATYEAFFTEHNATFPARSCVEVARLPKDVKIE IEAIAVRR
- Number of residues
- 128
- Molecular Weight
- 13611.475
- Theoretical pI
- 5.16
- GO Classification
- Functionsdeaminase activity / hydrolase activity / identical protein binding / unfolded protein bindingProcessesisoleucine biosynthetic process / response to toxic substanceComponentscytosol / membrane
- General Function
- Unfolded protein binding
- Specific Function
- Accelerates the release of ammonia from reactive enamine/imine intermediates of the PLP-dependent threonine dehydratase (IlvA) in the low water environment of the cell. It catalyzes the deamination of enamine/imine intermediates to yield 2-ketobutyrate and ammonia. It is required for the detoxification of reactive intermediates of IlvA due to their highly nucleophilic abilities. Involved in the isoleucine biosynthesis (By similarity).
- Pfam Domain Function
- Ribonuc_L-PSP (PF01042)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0019231|2-iminobutanoate/2-iminopropanoate deaminase (ridA) ATGAGCAAAACTATCGCGACGGAAAATGCACCGGCAGCTATCGGTCCTTACGTACAGGGC GTTGATCTGGGCAATATGATCATCACCTCCGGTCAGATCCCGGTAAATCCGAAAACGGGC GAAGTACCGGCAGACGTCGCTGCACAGGCACGTCAGTCGCTGGATAACGTAAAAGCGATC GTCGAAGCCGCTGGCCTGAAAGTGGGCGACATCGTTAAAACTACCGTGTTTGTAAAAGAT CTGAACGACTTCGCAACCGTAAACGCCACTTACGAAGCCTTCTTCACCGAACACAACGCC ACCTTCCCGGCACGTTCTTGCGTTGAAGTTGCCCGTCTGCCGAAAGACGTGAAGATTGAG ATCGAAGCGATCGCTGTTCGTCGCTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0AF93 UniProtKB Entry Name RIDA_ECOLI GenBank Gene ID U14003 - General References
- Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL, Blattner FR: Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes. Nucleic Acids Res. 1995 Jun 25;23(12):2105-19. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Link AJ, Robison K, Church GM: Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12. Electrophoresis. 1997 Aug;18(8):1259-313. [Article]
- Fountoulakis M, Takacs MF, Berndt P, Langen H, Takacs B: Enrichment of low abundance proteins of Escherichia coli by hydroxyapatite chromatography. Electrophoresis. 1999 Aug;20(11):2181-95. [Article]
- Volz K: A test case for structure-based functional assignment: the 1.2 A crystal structure of the yjgF gene product from Escherichia coli. Protein Sci. 1999 Nov;8(11):2428-37. [Article]