Mannose-binding protein C
Details
- Name
- Mannose-binding protein C
- Synonyms
- COLEC1
- Collectin-1
- Mannan-binding protein
- Mannose-binding lectin
- MBL
- MBP-C
- MBP1
- Gene Name
- MBL2
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0013136|Mannose-binding protein C MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG EPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH LAVCEFPI
- Number of residues
- 248
- Molecular Weight
- 26143.345
- Theoretical pI
- Not Available
- GO Classification
- Functionscalcium ion binding / calcium-dependent protein binding / mannose binding / receptor bindingProcessesacute-phase response / complement activation / complement activation, classical pathway / complement activation, lectin pathway / defense response to bacterium / defense response to Gram-positive bacterium / innate immune response / killing by host of symbiont cells / negative regulation of growth of symbiont in host / negative regulation of viral process / opsonization / positive regulation of phagocytosis / response to oxidative stressComponentscell surface / collagen trimer / extracellular region / extracellular space
- General Function
- Receptor binding
- Specific Function
- Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0013137|Mannose-binding protein C (MBL2) ATGTCCCTGTTTCCATCACTCCCTCTCCTTCTCCTGAGTATGGTGGCAGCGTCTTACTCA GAAACTGTGACCTGTGAGGATGCCCAAAAGACCTGCCCTGCAGTGATTGCCTGTAGCTCT CCAGGCATCAACGGCTTCCCAGGCAAAGATGGGCGTGATGGCACCAAGGGAGAAAAGGGG GAACCAGGCCAAGGGCTCAGAGGCTTACAGGGCCCCCCTGGAAAGTTGGGGCCTCCAGGA AATCCAGGGCCTTCTGGGTCACCAGGACCAAAGGGCCAAAAAGGAGACCCTGGAAAAAGT CCGGATGGTGATAGTAGCCTGGCTGCCTCAGAAAGAAAAGCTCTGCAAACAGAAATGGCA CGTATCAAAAAGTGGCTCACCTTCTCTCTGGGCAAACAAGTTGGGAACAAGTTCTTCCTG ACCAATGGTGAAATAATGACCTTTGAAAAAGTGAAGGCCTTGTGTGTCAAGTTCCAGGCC TCTGTGGCCACCCCCAGGAATGCTGCAGAGAATGGAGCCATTCAGAATCTCATCAAGGAG GAAGCCTTCCTGGGCATCACTGATGAGAAGACAGAAGGGCAGTTTGTGGATCTGACAGGA AATAGACTGACCTACACAAACTGGAACGAGGGTGAACCCAACAATGCTGGTTCTGATGAA GATTGTGTATTGCTACTGAAAAATGGCCAGTGGAATGACGTCCCCTGCTCCACCTCCCAT CTGGCCGTCTGTGAGTTCCCTATCTGA
- Chromosome Location
- 10
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P11226 UniProtKB Entry Name MBL2_HUMAN HGNC ID HGNC:6922 - General References
- Ezekowitz RA, Day LE, Herman GA: A human mannose-binding protein is an acute-phase reactant that shares sequence homology with other vertebrate lectins. J Exp Med. 1988 Mar 1;167(3):1034-46. [Article]
- Sastry K, Herman GA, Day L, Deignan E, Bruns G, Morton CC, Ezekowitz RA: The human mannose-binding protein gene. Exon structure reveals its evolutionary relationship to a human pulmonary surfactant gene and localization to chromosome 10. J Exp Med. 1989 Oct 1;170(4):1175-89. [Article]
- Taylor ME, Brickell PM, Craig RK, Summerfield JA: Structure and evolutionary origin of the gene encoding a human serum mannose-binding protein. Biochem J. 1989 Sep 15;262(3):763-71. [Article]
- Madsen HO, Satz ML, Hogh B, Svejgaard A, Garred P: Different molecular events result in low protein levels of mannan-binding lectin in populations from southeast Africa and South America. J Immunol. 1998 Sep 15;161(6):3169-75. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Juliger S, Kremsner PG, Alpers MP, Reeder JC, Kun JF: Restricted polymorphisms of the mannose-binding lectin gene in a population of Papua New Guinea. Mutat Res. 2002 Aug 29;505(1-2):87-91. [Article]
- Kurata H, Sannoh T, Kozutsumi Y, Yokota Y, Kawasaki T: Structure and function of mannan-binding proteins isolated from human liver and serum. J Biochem. 1994 Jun;115(6):1148-54. [Article]
- Thiel S, Vorup-Jensen T, Stover CM, Schwaeble W, Laursen SB, Poulsen K, Willis AC, Eggleton P, Hansen S, Holmskov U, Reid KB, Jensenius JC: A second serine protease associated with mannan-binding lectin that activates complement. Nature. 1997 Apr 3;386(6624):506-10. [Article]
- Nauta AJ, Raaschou-Jensen N, Roos A, Daha MR, Madsen HO, Borrias-Essers MC, Ryder LP, Koch C, Garred P: Mannose-binding lectin engagement with late apoptotic and necrotic cells. Eur J Immunol. 2003 Oct;33(10):2853-63. [Article]
- Palaniyar N, Nadesalingam J, Clark H, Shih MJ, Dodds AW, Reid KB: Nucleic acid is a novel ligand for innate, immune pattern recognition collectins surfactant proteins A and D and mannose-binding lectin. J Biol Chem. 2004 Jul 30;279(31):32728-36. Epub 2004 May 15. [Article]
- Hirano M, Ma BY, Kawasaki N, Okimura K, Baba M, Nakagawa T, Miwa K, Kawasaki N, Oka S, Kawasaki T: Mannan-binding protein blocks the activation of metalloproteases meprin alpha and beta. J Immunol. 2005 Sep 1;175(5):3177-85. [Article]
- Hummelshoj T, Fog LM, Madsen HO, Sim RB, Garred P: Comparative study of the human ficolins reveals unique features of Ficolin-3 (Hakata antigen). Mol Immunol. 2008 Mar;45(6):1623-32. Epub 2007 Nov 19. [Article]
- Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
- Sheriff S, Chang CY, Ezekowitz RA: Human mannose-binding protein carbohydrate recognition domain trimerizes through a triple alpha-helical coiled-coil. Nat Struct Biol. 1994 Nov;1(11):789-94. [Article]
- Sumiya M, Super M, Tabona P, Levinsky RJ, Arai T, Turner MW, Summerfield JA: Molecular basis of opsonic defect in immunodeficient children. Lancet. 1991 Jun 29;337(8757):1569-70. [Article]
- Lipscombe RJ, Sumiya M, Hill AV, Lau YL, Levinsky RJ, Summerfield JA, Turner MW: High frequencies in African and non-African populations of independent mutations in the mannose binding protein gene. Hum Mol Genet. 1992 Dec;1(9):709-15. [Article]
- Super M, Gillies SD, Foley S, Sastry K, Schweinle JE, Silverman VJ, Ezekowitz RA: Distinct and overlapping functions of allelic forms of human mannose binding protein. Nat Genet. 1992 Sep;2(1):50-5. [Article]
- Gabolde M, Muralitharan S, Besmond C: Genotyping of the three major allelic variants of the human mannose-binding lectin gene by denaturing gradient gel electrophoresis. Hum Mutat. 1999;14(1):80-3. [Article]
- Thio CL, Mosbruger T, Astemborski J, Greer S, Kirk GD, O'Brien SJ, Thomas DL: Mannose binding lectin genotypes influence recovery from hepatitis B virus infection. J Virol. 2005 Jul;79(14):9192-6. [Article]
- Thye T, Niemann S, Walter K, Homolka S, Intemann CD, Chinbuah MA, Enimil A, Gyapong J, Osei I, Owusu-Dabo E, Rusch-Gerdes S, Horstmann RD, Ehlers S, Meyer CG: Variant G57E of mannose binding lectin associated with protection against tuberculosis caused by Mycobacterium africanum but not by M. tuberculosis. PLoS One. 2011;6(6):e20908. doi: 10.1371/journal.pone.0020908. Epub 2011 Jun 10. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01818 O3-Sulfonylgalactose experimental unknown Details DB01979 Methyl alpha-D-mannoside experimental unknown Details DB02837 4-(Hydrogen sulfate)-beta-D-galactopyranose experimental unknown Details DB03194 Methyl beta-L-fucopyranoside experimental unknown Details DB03721 N-acetyl-alpha-neuraminic acid experimental unknown Details DB03879 alpha-L-methyl-fucose experimental unknown Details DB04426 Alpha-Methyl-N-Acetyl-D-Glucosamine experimental unknown Details