Heat-labile enterotoxin B chain
Details
- Name
- Heat-labile enterotoxin B chain
- Synonyms
- LT-B, porcine
- LTP-B
- ltpB
- Gene Name
- eltB
- Organism
- Escherichia coli
- Amino acid sequence
>lcl|BSEQ0011042|Heat-labile enterotoxin B chain MNKVKCYVLFTALLSSLYAHGAPQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVI ITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAI SMKN
- Number of residues
- 124
- Molecular Weight
- 14133.255
- Theoretical pI
- 9.12
- GO Classification
- Processeskilling of cells of other organism / pathogenesisComponentsextracellular region
- General Function
- Not Available
- Specific Function
- The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
- Pfam Domain Function
- Enterotoxin_b (PF01376)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0002931|375 bp ATGAATAAAGTAAAATGTTATGTTTTATTTACGGCGTTACTATCCTCTCTATATGCACAC GGAGCTCCCCAGACTATTACAGAACTATGTTCGGAATATCGCAACACACAAATATATACG ATAAATGACAAGATACTATCATATACGGAATCGATGGCAGGCAAAAGAGAAATGGTTATC ATTACATTTAAGAGCGGCGAAACATTTCAGGTCGAAGTCCCGGGCAGTCAACATATAGAC TCCCAGAAAAAAGCCATTGAAAGGATGAAGGACACATTAAGAATCACATATCTGACCGAG ACCAAAATTGATAAATTATGTGTATGGAATAATAAAACCCCCAATTCAATTGCGGCAATC AGTATGAAAAACTAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P32890 UniProtKB Entry Name ELBP_ECOLX GenBank Protein ID 145833 GenBank Gene ID M17873 - General References
- Dallas WS, Falkow S: Amino acid sequence homology between cholera toxin and Escherichia coli heat-labile toxin. Nature. 1980 Dec 4;288(5790):499-501. [Article]
- Leong J, Vinal AC, Dallas WS: Nucleotide sequence comparison between heat-labile toxin B-subunit cistrons from Escherichia coli of human and porcine origin. Infect Immun. 1985 Apr;48(1):73-7. [Article]
- Yamamoto T, Gojobori T, Yokota T: Evolutionary origin of pathogenic determinants in enterotoxigenic Escherichia coli and Vibrio cholerae O1. J Bacteriol. 1987 Mar;169(3):1352-7. [Article]
- Ibrahimi I, Gentz R: A functional interaction between the signal peptide and the translation apparatus is detected by the use of a single point mutation which blocks translocation across mammalian endoplasmic reticulum. J Biol Chem. 1987 Jul 25;262(21):10189-94. [Article]
- Tsuji T, Iida T, Honda T, Miwatani T, Nagahama M, Sakurai J, Wada K, Matsubara H: A unique amino acid sequence of the B subunit of a heat-labile enterotoxin isolated from a human enterotoxigenic Escherichia coli. Microb Pathog. 1987 May;2(5):381-90. [Article]
- Sixma TK, Kalk KH, van Zanten BA, Dauter Z, Kingma J, Witholt B, Hol WG: Refined structure of Escherichia coli heat-labile enterotoxin, a close relative of cholera toxin. J Mol Biol. 1993 Apr 5;230(3):890-918. [Article]
- Sixma TK, Pronk SE, Kalk KH, Wartna ES, van Zanten BA, Witholt B, Hol WG: Crystal structure of a cholera toxin-related heat-labile enterotoxin from E. coli. Nature. 1991 May 30;351(6325):371-7. [Article]
- Pickens JC, Merritt EA, Ahn M, Verlinde CL, Hol WG, Fan E: Anchor-based design of improved cholera toxin and E. coli heat-labile enterotoxin receptor binding antagonists that display multiple binding modes. Chem Biol. 2002 Feb;9(2):215-24. [Article]
- Domenighini M, Pizza M, Jobling MG, Holmes RK, Rappuoli R: Identification of errors among database sequence entries and comparison of correct amino acid sequences for the heat-labile enterotoxins of Escherichia coli and Vibrio cholerae. Mol Microbiol. 1995 Mar;15(6):1165-7. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB02213 Metanitrophenyl-Alpha-D-Galactoside experimental unknown Details DB03242 P-Aminophenyl-Alpha-D-Galactopyranoside experimental unknown Details DB03421 2-Phenethyl-2,3-Dihydro-Phthalazine-1,4-Dione experimental unknown Details DB03446 N-Benzyl-3-(alpha-D-galactopyranosyloxy)benzamide experimental unknown Details DB04040 N-[1,3-Di(4-morpholinyl)-2-propanyl]-3-(α-D-galactopyranosyloxy)-5-nitrobenzamide experimental unknown Details DB04396 Thiodigalactoside experimental unknown Details