Calcium/calmodulin-dependent protein kinase type 1
Details
- Name
- Calcium/calmodulin-dependent protein kinase type 1
- Synonyms
- 2.7.11.17
- CaM kinase I
- CaM kinase I alpha
- CaM-KI
- CaMKI-alpha
- Gene Name
- CAMK1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0051712|Calcium/calmodulin-dependent protein kinase type 1 MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKE GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGT ELSPTLPHQL
- Number of residues
- 370
- Molecular Weight
- 41336.705
- Theoretical pI
- Not Available
- GO Classification
- FunctionsATP binding / calmodulin binding / calmodulin-dependent protein kinase activityProcessescell cycle / intracellular signal transduction / negative regulation of protein binding / nucleocytoplasmic transport / peptidyl-threonine phosphorylation / positive regulation of dendritic spine development / positive regulation of muscle cell differentiation / positive regulation of neuron projection development / positive regulation of peptidyl-serine phosphorylation / positive regulation of protein acetylation / positive regulation of protein export from nucleus / positive regulation of protein serine/threonine kinase activity / positive regulation of synapse structural plasticity / positive regulation of syncytium formation by plasma membrane fusion / positive regulation of transcription by RNA polymerase II / protein phosphorylation / regulation of muscle cell differentiation / regulation of protein binding / regulation of protein localization / signal transductionComponentscytoplasm / intracellular / nucleus
- General Function
- Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, regulates transcription activators activity, cell cycle, hormone production, cell differentiation, actin filament organization and neurite outgrowth. Recognizes the substrate consensus sequence [MVLIF]-x-R-x(2)-[ST]-x(3)-[MVLIF]. Regulates axonal extension and growth cone motility in hippocampal and cerebellar nerve cells. Upon NMDA receptor-mediated Ca(2+) elevation, promotes dendritic growth in hippocampal neurons and is essential in synapses for full long-term potentiation (LTP) and ERK2-dependent translational activation. Downstream of NMDA receptors, promotes the formation of spines and synapses in hippocampal neurons by phosphorylating ARHGEF7/BETAPIX on 'Ser-694', which results in the enhancement of ARHGEF7 activity and activation of RAC1. Promotes neuronal differentiation and neurite outgrowth by activation and phosphorylation of MARK2 on 'Ser-91', 'Ser-92', 'Ser-93' and 'Ser-294'. Promotes nuclear export of HDAC5 and binding to 14-3-3 by phosphorylation of 'Ser-259' and 'Ser-498' in the regulation of muscle cell differentiation. Regulates NUMB-mediated endocytosis by phosphorylation of NUMB on 'Ser-276' and 'Ser-295'. Involved in the regulation of basal and estrogen-stimulated migration of medulloblastoma cells through ARHGEF7/BETAPIX phosphorylation (By similarity). Is required for proper activation of cyclin-D1/CDK4 complex during G1 progression in diploid fibroblasts. Plays a role in K(+) and ANG2-mediated regulation of the aldosterone synthase (CYP11B2) to produce aldosterone in the adrenal cortex. Phosphorylates EIF4G3/eIF4GII. In vitro phosphorylates CREB1, ATF1, CFTR, MYL9 and SYN1/synapsin I.
- Specific Function
- Atp binding
- Pfam Domain Function
- Pkinase (PF00069)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0051713|Calcium/calmodulin-dependent protein kinase type 1 (CAMK1) ATGCTGGGGGCAGTGGAAGGCCCCAGGTGGAAGCAGGCGGAGGACATTAGAGACATCTAC GACTTCCGAGATGTTCTGGGCACGGGGGCCTTCTCGGAGGTGATCCTGGCAGAAGATAAG AGGACGCAGAAGCTGGTGGCCATCAAATGCATTGCCAAGGAGGCCCTGGAGGGCAAGGAA GGCAGCATGGAGAATGAGATTGCTGTCCTGCACAAGATCAAGCACCCCAACATTGTAGCC CTGGATGACATCTATGAGAGTGGGGGCCACCTCTACCTCATCATGCAGCTGGTGTCGGGT GGGGAGCTCTTTGACCGTATTGTGGAAAAAGGCTTCTACACGGAGCGGGACGCCAGCCGC CTCATCTTCCAGGTGCTGGATGCTGTGAAATACCTGCATGACCTGGGCATTGTACACCGG GATCTCAAGCCAGAGAATCTGCTGTACTACAGCCTGGATGAAGACTCCAAAATCATGATC TCCGACTTTGGCCTCTCCAAGATGGAGGACCCGGGCAGTGTGCTCTCCACCGCCTGTGGA ACTCCGGGATACGTGGCCCCTGAAGTCCTGGCCCAGAAGCCCTACAGCAAGGCTGTGGAT TGCTGGTCCATAGGTGTCATCGCCTACATCTTGCTCTGCGGTTACCCTCCCTTCTATGAC GAGAATGATGCCAAACTCTTTGAACAGATTTTGAAGGCCGAGTACGAGTTTGACTCTCCT TACTGGGACGACATCTCTGACTCTGCCAAAGATTTCATCCGGCACTTGATGGAGAAGGAC CCAGAGAAAAGATTCACCTGTGAGCAGGCCTTGCAGCACCCATGGATTGCAGGAGATACA GCTCTAGATAAGAATATCCACCAGTCGGTGAGTGAGCAGATCAAGAAGAACTTTGCCAAG AGCAAGTGGAAGCAAGCCTTCAATGCCACGGCTGTGGTGCGGCACATGAGGAAACTGCAG CTGGGCACCAGCCAGGAGGGGCAGGGGCAGACGGCGAGCCATGGGGAGCTGCTGACACCA GTGGCTGGGGGGCCGGCAGCTGGCTGTTGCTGTCGAGACTGCTGCGTGGAGCCGGGCACA GAACTGTCCCCCACACTGCCCCACCAGCTCTAG
- Chromosome Location
- 3
- Locus
- 3p25.3
- External Identifiers
Resource Link UniProtKB ID Q14012 UniProtKB Entry Name KCC1A_HUMAN HGNC ID HGNC:1459 - General References
- Haribabu B, Hook SS, Selbert MA, Goldstein EG, Tomhave ED, Edelman AM, Snyderman R, Means AR: Human calcium-calmodulin dependent protein kinase I: cDNA cloning, domain structure and activation by phosphorylation at threonine-177 by calcium-calmodulin dependent protein kinase I kinase. EMBO J. 1995 Aug 1;14(15):3679-86. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [Article]
- Hsu LS, Tsou AP, Chi CW, Lee CH, Chen JY: Cloning, expression and chromosomal localization of human Ca2+/calmodulin-dependent protein kinase kinase. J Biomed Sci. 1998;5(2):141-9. [Article]
- McKinsey TA, Zhang CL, Olson EN: Activation of the myocyte enhancer factor-2 transcription factor by calcium/calmodulin-dependent protein kinase-stimulated binding of 14-3-3 to histone deacetylase 5. Proc Natl Acad Sci U S A. 2000 Dec 19;97(26):14400-5. [Article]
- Hsu LS, Chen GD, Lee LS, Chi CW, Cheng JF, Chen JY: Human Ca2+/calmodulin-dependent protein kinase kinase beta gene encodes multiple isoforms that display distinct kinase activity. J Biol Chem. 2001 Aug 17;276(33):31113-23. Epub 2001 Jun 6. [Article]
- Condon JC, Pezzi V, Drummond BM, Yin S, Rainey WE: Calmodulin-dependent kinase I regulates adrenal cell expression of aldosterone synthase. Endocrinology. 2002 Sep;143(9):3651-7. [Article]
- Qin H, Raught B, Sonenberg N, Goldstein EG, Edelman AM: Phosphorylation screening identifies translational initiation factor 4GII as an intracellular target of Ca(2+)/calmodulin-dependent protein kinase I. J Biol Chem. 2003 Dec 5;278(49):48570-9. Epub 2003 Sep 24. [Article]
- Kahl CR, Means AR: Regulation of cyclin D1/Cdk4 complexes by calcium/calmodulin-dependent protein kinase I. J Biol Chem. 2004 Apr 9;279(15):15411-9. Epub 2004 Jan 30. [Article]
- Uboha NV, Flajolet M, Nairn AC, Picciotto MR: A calcium- and calmodulin-dependent kinase Ialpha/microtubule affinity regulating kinase 2 signaling cascade mediates calcium-dependent neurite outgrowth. J Neurosci. 2007 Apr 18;27(16):4413-23. [Article]
- Kamata A, Sakagami H, Tokumitsu H, Owada Y, Fukunaga K, Kondo H: Spatiotemporal expression of four isoforms of Ca2+/calmodulin-dependent protein kinase I in brain and its possible roles in hippocampal dendritic growth. Neurosci Res. 2007 Jan;57(1):86-97. Epub 2006 Oct 23. [Article]
- Saneyoshi T, Wayman G, Fortin D, Davare M, Hoshi N, Nozaki N, Natsume T, Soderling TR: Activity-dependent synaptogenesis: regulation by a CaM-kinase kinase/CaM-kinase I/betaPIX signaling complex. Neuron. 2008 Jan 10;57(1):94-107. doi: 10.1016/j.neuron.2007.11.016. [Article]
- Neal AP, Molina-Campos E, Marrero-Rosado B, Bradford AB, Fox SM, Kovalova N, Hannon HE: CaMKK-CaMKI signaling pathways differentially control axon and dendrite elongation in cortical neurons. J Neurosci. 2010 Feb 24;30(8):2807-9. doi: 10.1523/JNEUROSCI.5984-09.2010. [Article]
- Soderling TR, Stull JT: Structure and regulation of calcium/calmodulin-dependent protein kinases. Chem Rev. 2001 Aug;101(8):2341-52. [Article]
- Wayman GA, Lee YS, Tokumitsu H, Silva AJ, Soderling TR: Calmodulin-kinases: modulators of neuronal development and plasticity. Neuron. 2008 Sep 25;59(6):914-31. doi: 10.1016/j.neuron.2008.08.021. [Article]
- Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
- Skelding KA, Rostas JA, Verrills NM: Controlling the cell cycle: the role of calcium/calmodulin-stimulated protein kinases I and II. Cell Cycle. 2011 Feb 15;10(4):631-9. Epub 2011 Feb 15. [Article]
- Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. [Article]
- Mallampalli RK, Kaercher L, Snavely C, Pulijala R, Chen BB, Coon T, Zhao J, Agassandian M: Fbxl12 triggers G1 arrest by mediating degradation of calmodulin kinase I. Cell Signal. 2013 Oct;25(10):2047-59. doi: 10.1016/j.cellsig.2013.05.012. Epub 2013 May 23. [Article]
- Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
- Zha M, Zhong C, Ou Y, Han L, Wang J, Ding J: Crystal structures of human CaMKIalpha reveal insights into the regulation mechanism of CaMKI. PLoS One. 2012;7(9):e44828. doi: 10.1371/journal.pone.0044828. Epub 2012 Sep 20. [Article]
- Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [Article]