Phospholipase A2, membrane associated

Details

Name
Phospholipase A2, membrane associated
Synonyms
  • 3.1.1.4
  • GIIC sPLA2
  • Group IIA phospholipase A2
  • Non-pancreatic secretory phospholipase A2
  • NPS-PLA2
  • Phosphatidylcholine 2-acylhydrolase 2A
  • PLA2B
  • PLA2L
  • RASF-A
Gene Name
PLA2G2A
Organism
Human
Amino acid sequence
>lcl|BSEQ0016509|Phospholipase A2, membrane associated
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDAT
DRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFAR
NKTTYNKKYQYYSNKHCRGSTPRC
Number of residues
144
Molecular Weight
16082.525
Theoretical pI
9.51
GO Classification
Functions
calcium ion binding / phospholipase A2 activity / calcium-dependent phospholipase A2 activity / phospholipid binding
Processes
phosphatidylcholine acyl-chain remodeling / phosphatidylethanolamine acyl-chain remodeling / somatic stem cell population maintenance / phosphatidylglycerol acyl-chain remodeling / low-density lipoprotein particle remodeling / phosphatidylinositol acyl-chain remodeling / positive regulation of inflammatory response / phosphatidylserine acyl-chain remodeling / positive regulation of macrophage derived foam cell differentiation / positive regulation of ERK1 and ERK2 cascade / negative regulation of epithelial cell proliferation / glycerophospholipid biosynthetic process / defense response to Gram-positive bacterium / phospholipid metabolic process / phosphatidic acid metabolic process / small molecule metabolic process / lipid catabolic process / phosphatidic acid biosynthetic process
Components
mitochondrion / secretory granule / extracellular region / endoplasmic reticulum / extracellular space / endoplasmic reticulum membrane / extracellular exosome / perinuclear region of cytoplasm
General Function
Phospholipid binding
Specific Function
Thought to participate in the regulation of the phospholipid metabolism in biomembranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0016510|Phospholipase A2, membrane associated (PLA2G2A)
ATGAAGACCCTCCTACTGTTGGCAGTGATCATGATCTTTGGCCTACTGCAGGCCCATGGG
AATTTGGTGAATTTCCACAGAATGATCAAGTTGACGACAGGAAAGGAAGCCGCACTCAGT
TATGGCTTCTACGGCTGCCACTGTGGCGTGGGTGGCAGAGGATCCCCCAAGGATGCAACG
GATCGCTGCTGTGTCACTCATGACTGTTGCTACAAACGTCTGGAGAAACGTGGATGTGGC
ACCAAATTTCTGAGCTACAAGTTTAGCAACTCGGGGAGCAGAATCACCTGTGCAAAACAG
GACTCCTGCAGAAGTCAACTGTGTGAGTGTGATAAGGCTGCTGCCACCTGTTTTGCTAGA
AACAAGACGACCTACAATAAAAAGTACCAGTACTATTCCAATAAACACTGCAGAGGGAGC
ACCCCTCGTTGCTGA
Chromosome Location
1
Locus
1p35
External Identifiers
ResourceLink
UniProtKB IDP14555
UniProtKB Entry NamePA2GA_HUMAN
GenBank Protein ID190889
GenBank Gene IDM22430
GenAtlas IDPLA2G2A
HGNC IDHGNC:9031
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB019551,4-ButanediolexperimentalunknownDetails
DB02504[3-(1-Benzyl-3-Carbamoylmethyl-2-Methyl-1h-Indol-5-Yloxy)-Propyl-]-Phosphonic AcidexperimentalunknownDetails
DB029364-(1-Benzyl-3-Carbamoylmethyl-2-Methyl-1h-Indol-5-Yloxy)-Butyric AcidexperimentalunknownDetails
DB03121(1-Benzyl-5-methoxy-2-methyl-1H-indol-3-yl)acetic acidexperimentalunknownDetails
DB034716-Phenyl-4(R)-(7-Phenyl-Heptanoylamino)-Hexanoic AcidexperimentalunknownDetails
DB03784ElaidoylamideexperimentalunknownDetails
DB041121-Octadecyl-2-Acetamido-2-Deoxy-Sn-Glycerol-3-Phosphoethylmethyl SulfideexperimentalunknownDetails
DB04287(S)-5-(4-Benzyloxy-Phenyl)-4-(7-Phenyl-Heptanoylamino)-Pentanoic AcidexperimentalunknownDetails
DB02325Isopropyl Alcoholapproved, investigationalunknownDetails
DB04786SuramininvestigationalunknowninhibitorDetails
DB05737Varespladib methylinvestigationalunknownDetails
DB00328Indometacinapproved, investigationalyesinhibitorDetails
DB01381Ginkgo bilobaapproved, investigational, nutraceuticalunknowninhibitorDetails
DB03017Lauric Acidapproved, experimentalunknownDetails
DB02448N-Tridecanoic AcidexperimentalunknownDetails
DB020801-{2-[2-(2-Methoxyethoxy)Ethoxy]Ethoxy}-4-(1,1,3,3-Tetramethylbutyl)BenzeneexperimentalunknownDetails
DB00586Diclofenacapproved, vet_approvedunknowninhibitorDetails