High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A

Details

Name
High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A
Synonyms
  • 3.1.4.53
Gene Name
PDE8A
Organism
Humans
Amino acid sequence
>lcl|BSEQ0007139|High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A
MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSG
KKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF
LDKHHDIIIIDHRNPRQLDAEALCRSIRSSKLSENTVIVGVVRRVDREELSVMPFISAGF
TRRYVENPNIMACYNELLQLEFGEVRSQLKLRACNSVFTALENSEDAIEITSEDRFIQYA
NPAFETTMGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNI
QQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTGKHKDRRKGSL
DVKAVASRATEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLE
ILRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQMVSSNIITPIS
LDDVPPRIARAMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRS
WLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH
PGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQG
IIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEVINTMLRTPENRTLIKRM
LIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPKSQIS
FIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRNLRPPPE
Number of residues
829
Molecular Weight
93303.05
Theoretical pI
6.03
GO Classification
Functions
3',5'-cyclic-AMP phosphodiesterase activity / 3',5'-cyclic-nucleotide phosphodiesterase activity / metal ion binding
Processes
cAMP catabolic process / cyclic nucleotide metabolic process / regulation of transcription, DNA-templated / signal transduction
Components
cytosol / extracellular exosome
General Function
Metal ion binding
Specific Function
Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in maintaining basal levels of the cyclic nucleotide and/or in the cAMP regulation of germ cell development.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0020711|High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A (PDE8A)
ATGAGATTTCATCAAGATCAACTTCAGGTACTTTTAGTGTTTACCAAAGAAGATAACCAA
TGTAATGGATTCTGCAGGGCATGTGAAAAAGCAGGGTTTAAGTGTACAGTTACCAAGGAG
GCTCAGGCTGTCCTTGCCTGTTTCCTGGACAAACATCATGACATTATCATCATAGACCAC
AGAAATCCTCGACAGCTGGATGCAGAGGCACTGTGCAGGTCTATCAGATCATCAAAACTC
TCAGAAAACACAGTTATTGTTGGTGTAGTACGCAGGGTGGATAGAGAAGAGTTGTCCGTA
ATGCCTTTCATTTCTGCTGGATTTACAAGGAGGTATGTAGAAAACCCCAACATCATGGCC
TGCTACAATGAACTGCTCCAGCTGGAGTTTGGAGAGGTGCGATCACAACTGAAACTCAGG
GCTTGTAACTCAGTATTCACTGCATTAGAAAACAGTGAAGATGCAATTGAAATTACAAGC
GAAGACCGTTTTATACAGTATGCAAATCCTGCATTTGAAACAACAATGGGCTATCAGTCA
GGTGAATTAATAGGGAAGGAGTTAGGAGAAGTGCCTATAAATGAAAAAAAGGCTGACTTG
CTCGATACTATAAATTCATGCATCAGGATAGGCAAGGAGTGGCAAGGAATTTACTATGCC
AAAAAGAAAAACGGAGATAATATACAACAAAATGTGAAGATAATACCTGTCATTGGACAG
GGAGGAAAAATTAGACACTATGTGTCCATTATCAGAGTGTGCAATGGCAACAATAAGGCT
GAGAAAATATCCGAATGTGTTCAGTCTGACACTCATACAGATAATCAGACAGGCAAACAT
AAAGACAGGAGAAAAGGCTCACTAGACGTCAAAGCTGTTGCCTCCCGTGCAACTGAAGTT
TCCAGCCAGAGACGACACTCTTCCATGGCCCGGATACATTCCATGACAATTGAGGCGCCC
ATCACCAAGGTAATCAATATTATCAATGCTGCCCAGGAAAGTAGTCCCATGCCTGTGACA
GAAGCCCTAGACCGTGTGCTGGAAATTCTAAGAACCACTGAGTTATATTCACCACAGTTT
GGTGCTAAAGATGATGATCCCCATGCCAATGACCTTGTTGGGGGCTTAATGTCTGATGGT
TTGCGAAGACTATCAGGGAATGAATATGTTCTTTCAACAAAAAACACTCAAATGGTTTCA
AGCAATATAATCACTCCCATCTCCCTTGATGATGTCCCACCACGGATAGCTCGGGCCATG
GAAAATGAGGAATACTGGGACTTTGATATTTTTGAACTGGAGGCTGCCACCCACAATAGG
CCTTTGATTTATCTTGGTCTCAAAATGTTTGCTCGCTTTGGAATCTGTGAATTCTTACAC
TGCTCCGAGTCAACGCTAAGATCATGGTTACAAATTATCGAAGCCAATTATCATTCCTCC
AATCCCTACCACAATTCTACACATTCTGCTGATGTGCTTCATGCCACTGCCTATTTTCTC
TCCAAGGAGAGGATAAAGGAAACTTTAGATCCAATTGATGAGGTCGCTGCACTCATCGCA
GCCACCATTCATGATGTGGATCACCCTGGGAGAACCAACTCCTTCCTGTGTAATGCTGGA
AGTGAGCTGGCCATTTTGTACAATGACACTGCTGTGCTGGAGAGCCACCATGCGGCCTTG
GCCTTCCAGCTGACCACTGGAGATGATAAATGCAATATATTTAAAAACATGGAGAGGAAT
GATTATCGGACACTGCGCCAGGGGATTATCGACATGGTCTTAGCCACAGAAATGACAAAG
CACTTTGAGCATGTCAACAAATTTGTCAACAGCATCAACAAACCCTTGGCAACACTAGAA
GAAAATGGGGAAACTGATAAAAACCAGGAAGTGATAAACACTATGCTTAGGACTCCAGAG
AACCGGACCCTAATCAAACGAATGCTGATTAAATGTGCTGATGTGTCCAATCCCTGCCGA
CCCCTGCAGTACTGCATCGAGTGGGCTGCACGCATTTCGGAAGAATATTTTTCTCAGACT
GATGAAGAGAAGCAGCAGGGCTTACCTGTGGTGATGCCAGTGTTTGACAGAAATACCTGC
AGCATCCCCAAATCCCAAATCTCTTTCATTGATTACTTCATCACAGACATGTTTGATGCT
TGGGATGCCTTTGTAGACCTGCCTGATTTAATGCAGCATCTTGACAACAACTTTAAATAC
TGGAAAGGACTGGACGAAATGAAGCTGCGGAACCTCCGACCACCTCCTGAATAG
Chromosome Location
15
Locus
15q25.3
External Identifiers
ResourceLink
UniProtKB IDO60658
UniProtKB Entry NamePDE8A_HUMAN
GenBank Protein ID16417190
GenBank Gene IDAF388183
HGNC IDHGNC:8793
General References
  1. Wang P, Wu P, Egan RW, Billah MM: Human phosphodiesterase 8A splice variants: cloning, gene organization, and tissue distribution. Gene. 2001 Dec 12;280(1-2):183-94. [PubMed:11738832]
  2. Glavas NA, Ostenson C, Schaefer JB, Vasta V, Beavo JA: T cell activation up-regulates cyclic nucleotide phosphodiesterases 8A1 and 7A3. Proc Natl Acad Sci U S A. 2001 May 22;98(11):6319-24. [PubMed:11371644]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Fisher DA, Smith JF, Pillar JS, St Denis SH, Cheng JB: Isolation and characterization of PDE8A, a novel human cAMP-specific phosphodiesterase. Biochem Biophys Res Commun. 1998 May 29;246(3):570-7. [PubMed:9618252]
  7. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976]
  8. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  9. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  10. Brown KM, Lee LC, Findlay JE, Day JP, Baillie GS: Cyclic AMP-specific phosphodiesterase, PDE8A1, is activated by protein kinase A-mediated phosphorylation. FEBS Lett. 2012 Jun 4;586(11):1631-7. doi: 10.1016/j.febslet.2012.04.033. Epub 2012 May 3. [PubMed:22673573]
  11. Wang H, Yan Z, Yang S, Cai J, Robinson H, Ke H: Kinetic and structural studies of phosphodiesterase-8A and implication on the inhibitor selectivity. Biochemistry. 2008 Dec 2;47(48):12760-8. doi: 10.1021/bi801487x. [PubMed:18983167]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB079543-isobutyl-1-methyl-7H-xanthineexperimentalunknownDetails
DB00201CaffeineapprovedunknowninhibitorDetails
DB09283TrapidilexperimentalyesinhibitorDetails