Haptoglobin-related protein

Details

Name
Haptoglobin-related protein
Synonyms
Not Available
Gene Name
HPR
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049826|Haptoglobin-related protein
MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLR
TEGDGVYTLNDKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAK
MVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVL
HPNYHQVDIGLIKLKQKVLVNERVMPICLPSKNYAEVGRVGYVSGWGQSDNFKLTDHLKY
VMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHTFCVGMSKYQEDTCYGDAGSA
FAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN
Number of residues
348
Molecular Weight
39029.345
Theoretical pI
Not Available
GO Classification
Functions
hemoglobin binding
Processes
receptor-mediated endocytosis
Components
blood microparticle / extracellular exosome / extracellular region / spherical high-density lipoprotein particle
General Function
Primate-specific plasma protein associated with apolipoprotein L-I (apoL-I)-containing high-density lipoprotein (HDL). This HDL particle, termed trypanosome lytic factor-1 (TLF-1), mediates human innate immune protection against many species of African trypanosomes. Binds hemoglobin with high affinity and may contribute to the clearance of cell-free hemoglobin to allow hepatic recycling of heme iron.
Specific Function
Hemoglobin binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0049827|Haptoglobin-related protein (HPR)
ATGAGTGACCTGGGAGCTGTCATTTCCCTCCTGCTCTGGGGACGACAGCTTTTTGCACTG
TACTCAGGCAATGATGTCACGGATATTTCAGATGACCGCTTCCCGAAGCCCCCTGAGATT
GCAAATGGCTATGTGGAGCACTTGTTTCGCTACCAGTGTAAGAACTACTACAGACTGCGC
ACAGAAGGAGATGGAGTATACACCTTAAATGATAAGAAGCAGTGGATAAATAAGGCTGTT
GGAGATAAACTTCCTGAATGTGAAGCAGTATGTGGGAAGCCCAAGAATCCGGCAAACCCA
GTGCAGCGGATCCTGGGTGGACACCTGGATGCCAAAGGCAGCTTTCCCTGGCAGGCTAAG
ATGGTTTCCCACCATAATCTCACCACAGGGGCCACGCTGATCAATGAACAATGGCTGCTG
ACCACGGCTAAAAATCTCTTCCTGAACCATTCAGAAAATGCAACAGCGAAAGACATTGCC
CCTACTTTAACACTCTATGTGGGGAAAAAGCAGCTTGTAGAGATTGAGAAGGTGGTTCTA
CACCCTAACTACCACCAGGTAGATATTGGGCTCATCAAACTCAAACAGAAGGTGCTTGTT
AATGAGAGAGTGATGCCCATCTGCCTACCTTCAAAGAATTATGCAGAAGTAGGGCGTGTG
GGTTACGTGTCTGGCTGGGGACAAAGTGACAACTTTAAACTTACTGACCATCTGAAGTAT
GTCATGCTGCCTGTGGCTGACCAATACGATTGCATAACGCATTATGAAGGCAGCACATGC
CCCAAATGGAAGGCACCGAAGAGCCCTGTAGGGGTGCAGCCCATACTGAACGAACACACC
TTCTGTGTCGGCATGTCTAAGTACCAGGAAGACACCTGCTATGGCGATGCGGGCAGTGCC
TTTGCCGTTCACGACCTGGAGGAGGACACCTGGTACGCGGCTGGGATCCTAAGCTTTGAT
AAGAGCTGTGCTGTGGCTGAGTATGGTGTGTATGTGAAGGTGACTTCCATCCAGCACTGG
GTTCAGAAGACCATAGCTGAGAACTAA
Chromosome Location
16
Locus
16q22.2
External Identifiers
ResourceLink
UniProtKB IDP00739
UniProtKB Entry NameHPTR_HUMAN
HGNC IDHGNC:5156
General References
  1. Bensi G, Raugei G, Klefenz H, Cortese R: Structure and expression of the human haptoglobin locus. EMBO J. 1985 Jan;4(1):119-26. [PubMed:4018023]
  2. Maeda N: Nucleotide sequence of the haptoglobin and haptoglobin-related gene pair. The haptoglobin-related gene contains a retrovirus-like element. J Biol Chem. 1985 Jun 10;260(11):6698-709. [PubMed:2987228]
  3. Erickson LM, Kim HS, Maeda N: Junctions between genes in the haptoglobin gene cluster of primates. Genomics. 1992 Dec;14(4):948-58. [PubMed:1478675]
  4. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553]
  5. Tabak S, Lev A, Valansi C, Aker O, Shalitin C: Transcriptionally active haptoglobin-related (Hpr) gene in hepatoma G2 and leukemia molt-4 cells. DNA Cell Biol. 1996 Nov;15(11):1001-7. [PubMed:8945641]
  6. Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J, Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y, Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC, Adams MD: Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q. Genomics. 1999 Sep 15;60(3):295-308. [PubMed:10493829]
  7. Nielsen MJ, Petersen SV, Jacobsen C, Oxvig C, Rees D, Moller HJ, Moestrup SK: Haptoglobin-related protein is a high-affinity hemoglobin-binding plasma protein. Blood. 2006 Oct 15;108(8):2846-9. Epub 2006 Jun 15. [PubMed:16778136]
  8. Harrington JM, Nishanova T, Pena SR, Hess M, Scelsi CL, Widener J, Hajduk SL: A retained secretory signal peptide mediates high density lipoprotein (HDL) assembly and function of haptoglobin-related protein. J Biol Chem. 2014 Sep 5;289(36):24811-20. doi: 10.1074/jbc.M114.567578. Epub 2014 Jul 17. [PubMed:25037218]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09130Copperapproved, investigationalunknownDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails