Complement component C8 beta chain

Details

Name
Complement component C8 beta chain
Synonyms
  • Complement component 8 subunit beta
Gene Name
C8B
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049814|Complement component C8 beta chain
MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTL
MPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGIN
LFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDF
ERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLE
VAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVM
NKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFA
YSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRK
NTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Number of residues
591
Molecular Weight
67046.35
Theoretical pI
Not Available
GO Classification
Functions
protein complex binding
Processes
complement activation / complement activation, alternative pathway / complement activation, classical pathway / cytolysis / immune response / regulation of complement activation
Components
extracellular exosome / extracellular region / extracellular space / extracellular vesicle / membrane / membrane attack complex
General Function
Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells.
Specific Function
Protein complex binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0049815|Complement component C8 beta chain (C8B)
ATGAAGAATTCCAGGACATGGGCTTGGAGGGCGCCGGTGGAGCTATTTCTTCTCTGTGCT
GCCCTGGGCTGTCTCAGTTTGCCTGGCTCCAGAGGTGAAAGGCCACATTCCTTTGGGTCA
AATGCAGTCAACAAGAGCTTTGCTAAGAGCAGACAGATGCGGAGTGTGGATGTTACCCTG
ATGCCCATTGATTGTGAGCTGTCTAGTTGGTCCTCTTGGACCACATGTGACCCCTGTCAG
AAGAAAAGGTACAGGTATGCCTACTTGCTCCAGCCCTCTCAGTTCCATGGGGAACCGTGC
AACTTCTCTGACAAGGAAGTCGAAGACTGTGTTACCAACAGACCATGCAGAAGTCAAGTG
CGATGTGAAGGCTTTGTGTGTGCACAGACAGGAAGGTGTGTAAACCGCAGACTTCTTTGC
AATGGGGACAATGACTGTGGAGACCAGTCAGATGAAGCAAACTGTAGAAGGATTTATAAA
AAATGTCAGCATGAAATGGACCAATACTGGGGAATTGGCAGTCTGGCCAGTGGGATAAAT
TTGTTCACAAACAGTTTTGAGGGCCCAGTTCTTGATCACAGGTATTATGCAGGTGGATGC
TCCCCGCATTACATCCTGAACACGAGGTTTAGGAAGCCCTACAATGTGGAAAGCTACACG
CCACAGACCCAAGGCAAATACGAATTCATATTAAAAGAGTATGAATCATACTCAGATTTT
GAACGCAATGTCACAGAGAAAATGGCAAGCAAGTCTGGTTTCAGTTTTGGTTTTAAAATA
CCTGGAATATTTGAACTTGGCATCAGTAGTCAAAGTGATCGAGGCAAACACTATATTAGG
AGAACCAAACGATTCTCTCATACTAAAAGCGTATTTCTGCATGCACGCTCTGACCTTGAA
GTAGCACATTACAAGCTGAAACCCAGAAGCCTCATGCTCCATTACGAGTTCCTTCAGAGA
GTTAAGCGGCTGCCCCTGGAGTACAGCTACGGGGAATACAGAGATCTCTTCCGTGATTTT
GGGACCCACTACATCACAGAGGCTGTGCTTGGGGGCATTTATGAATACACCCTCGTTATG
AACAAAGAGGCCATGGAGAGAGGAGATTATACTCTTAACAACGTCCATGCCTGTGCCAAA
AATGATTTTAAAATTGGTGGTGCCATTGAAGAGGTCTACGTCAGTCTGGGTGTGTCTGTA
GGCAAATGCAGAGGTATTCTGAATGAAATAAAAGACAGAAACAAGAGGGACACCATGGTG
GAGGACTTGGTGGTCCTGGTACGAGGAGGGGCAAGTGAGCACATCACCACCCTGGCATAC
CAGGAGCTGCCGACGGCGGACCTGATGCAGGAGTGGGGAGACGCTGTGCAGTACAACCCA
GCCATCATCAAAGTTAAGGTGGAGCCTCTGTATGAACTAGTGACAGCCACAGATTTTGCC
TATTCCAGCACAGTGAGGCAGAACATGAAGCAGGCACTGGAGGAGTTCCAGAAGGAAGTT
AGTTCCTGCCACTGTGCTCCCTGCCAAGGAAATGGAGTCCCTGTCCTGAAAGGATCACGC
TGTGACTGCATCTGTCCTGTTGGATCCCAAGGCCTAGCCTGTGAGGTCTCCTATCGGAAG
AATACCCCCATTGATGGGAAGTGGAATTGCTGGTCAAATTGGTCTTCATGCTCTGGAAGA
CGTAAGACAAGACAAAGGCAGTGTAACAATCCACCTCCTCAAAATGGGGGTAGCCCCTGT
TCAGGCCCTGCTTCAGAAACACTTGACTGCTCCTAG
Chromosome Location
1
Locus
1p32.2
External Identifiers
ResourceLink
UniProtKB IDP07358
UniProtKB Entry NameCO8B_HUMAN
HGNC IDHGNC:1353
General References
  1. Howard OM, Rao AG, Sodetz JM: Complementary DNA and derived amino acid sequence of the beta subunit of human complement protein C8: identification of a close structural and ancestral relationship to the alpha subunit and C9. Biochemistry. 1987 Jun 16;26(12):3565-70. [PubMed:2820472]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Haefliger JA, Tschopp J, Nardelli D, Wahli W, Kocher HP, Tosi M, Stanley KK: Complementary DNA cloning of complement C8 beta and its sequence homology to C9. Biochemistry. 1987 Jun 16;26(12):3551-6. [PubMed:3651397]
  6. Steckel EW, York RG, Monahan JB, Sodetz JM: The eighth component of human complement. Purification and physicochemical characterization of its unusual subunit structure. J Biol Chem. 1980 Dec 25;255(24):11997-2005. [PubMed:7440581]
  7. Hofsteenge J, Blommers M, Hess D, Furmanek A, Miroshnichenko O: The four terminal components of the complement system are C-mannosylated on multiple tryptophan residues. J Biol Chem. 1999 Nov 12;274(46):32786-94. [PubMed:10551839]
  8. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952]
  9. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218]
  10. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  11. Lovelace LL, Cooper CL, Sodetz JM, Lebioda L: Structure of human C8 protein provides mechanistic insight into membrane pore formation by complement. J Biol Chem. 2011 May 20;286(20):17585-92. doi: 10.1074/jbc.M111.219766. Epub 2011 Mar 25. [PubMed:21454577]
  12. Dewald G, Hemmer S, Nothen MM: Human complement component C8. Molecular basis of the beta-chain polymorphism. FEBS Lett. 1994 Mar 7;340(3):211-5. [PubMed:8131848]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09130Copperapproved, investigationalunknownDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails