Carboxypeptidase N catalytic chain

Details

Name
Carboxypeptidase N catalytic chain
Synonyms
  • 3.4.17.3
  • ACBP
  • Anaphylatoxin inactivator
  • Arginine carboxypeptidase
  • Carboxypeptidase N polypeptide 1
  • Carboxypeptidase N small subunit
  • CPN
  • Kininase-1
  • Lysine carboxypeptidase
  • Plasma carboxypeptidase B
  • SCPN
  • Serum carboxypeptidase N
Gene Name
CPN1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017120|Carboxypeptidase N catalytic chain
MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHL
YVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQD
TRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPN
HHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRT
ASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT
NCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVIS
VSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIP
QVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA
Number of residues
458
Molecular Weight
52285.935
Theoretical pI
7.36
GO Classification
Functions
metallocarboxypeptidase activity / serine-type carboxypeptidase activity / zinc ion binding
Processes
bradykinin catabolic process / peptide metabolic process / protein processing / response to glucocorticoid
Components
extracellular space
General Function
Zinc ion binding
Specific Function
Protects the body from potent vasoactive and inflammatory peptides containing C-terminal Arg or Lys (such as kinins or anaphylatoxins) which are released into the circulation.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0017121|Carboxypeptidase N catalytic chain (CPN1)
ATGTCAGACCTGCTCTCAGTCTTCCTCCACCTCCTCCTTCTCTTCAAGTTGGTTGCCCCG
GTGACCTTTCGCCACCACCGCTATGATGATCTTGTGCGGACGCTGTACAAGGTGCAAAAC
GAATGCCCCGGCATCACGCGGGTCTACAGCATTGGGCGCAGCGTGGAGGGGAGACACCTC
TACGTGCTGGAGTTCAGCGACCACCCTGGAATCCACGAGCCCTTGGAACCAGAGGTCAAG
TATGTGGGGAACATGCACGGCAACGAAGCGTTGGGCCGCGAGCTGATGCTGCAGCTGTCG
GAGTTTCTGTGCGAGGAGTTCCGGAACAGGAACCAGCGCATCGTCCAGCTCATCCAGGAC
ACGCGCATTCACATCCTGCCATCCATGAACCCCGACGGCTACGAGGTGGCTGCTGCCCAG
GGCCCAAACAAGCCTGGGTATCTAGTTGGCAGGAACAATGCAAATGGAGTGGACCTGAAC
CGCAACTTCCCTGATCTCAATACCTATATCTACTATAACGAGAAGTACGGAGGCCCCAAC
CACCACCTGCCCCTTCCAGACAACTGGAAAAGTCAGGTGGAACCCGAGACCCGGGCGGTG
ATCCGGTGGATGCACTCCTTCAACTTTGTTCTTTCAGCCAATCTCCACGGAGGGGCGGTG
GTGGCCAATTACCCGTATGACAAGTCCTTTGAGCACCGGGTCCGAGGGGTCCGCCGCACC
GCCAGCACCCCCACGCCTGACGACAAGCTCTTCCAGAAGCTGGCCAAGGTCTACTCCTAT
GCACATGGATGGATGTTCCAAGGTTGGAACTGCGGAGATTACTTCCCAGATGGCATCACC
AATGGGGCTTCCTGGTATTCTCTCAGCAAGGGAATGCAAGACTTTAATTATCTCCATACC
AACTGCTTTGAGATCACGCTGGAACTGAGTTGCGACAAGTTTCCCCCCGAAGAGGAGTTA
CAGCGGGAGTGGCTGGGTAATCGGGAAGCCCTAATCCAGTTCCTGGAACAGGTTCACCAG
GGCATCAAGGGAATGGTGCTTGATGAGAATTACAATAATCTCGCCAATGCTGTCATTTCT
GTCAGTGGGATTAACCATGATGTCACTTCAGGTGACCATGGTGATTACTTCCGGCTGCTG
CTTCCAGGTATCTACACTGTTAGTGCCACAGCACCTGGGTATGACCCAGAGACAGTAACT
GTGACCGTGGGTCCTGCGGAACCAACGTTGGTTAACTTCCACCTCAAAAGAAGCATCCCT
CAAGTAAGCCCTGTGAGGAGAGCTCCCAGCAGAAGGCACGGAGTCAGAGCCAAAGTGCAG
CCCCAAGCCAGAAAGAAAGAAATGGAGATGAGGCAGCTGCAGAGAGGCCCTGCCTGA
Chromosome Location
10
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP15169
UniProtKB Entry NameCBPN_HUMAN
GenBank Gene IDBC027897
GenAtlas IDCPN1
HGNC IDHGNC:2312
General References
  1. Gebhard W, Schube M, Eulitz M: cDNA cloning and complete primary structure of the small, active subunit of human carboxypeptidase N (kininase 1). Eur J Biochem. 1989 Jan 2;178(3):603-7. [PubMed:2912725]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Skidgel RA, Bennett CD, Schilling JW, Tan FL, Weerasinghe DK, Erdos EG: Amino acid sequence of the N-terminus and selected tryptic peptides of the active subunit of human plasma carboxypeptidase N: comparison with other carboxypeptidases. Biochem Biophys Res Commun. 1988 Aug 15;154(3):1323-9. [PubMed:3408501]
  5. Hendriks D, Vingron M, Vriend G, Wang W, Nalis D, Scharpe S: On the specificity of carboxypeptidase N, a comparative study. Biol Chem Hoppe Seyler. 1993 Sep;374(9):843-9. [PubMed:8267877]
  6. Keil C, Maskos K, Than M, Hoopes JT, Huber R, Tan F, Deddish PA, Erdos EG, Skidgel RA, Bode W: Crystal structure of the human carboxypeptidase N (kininase I) catalytic domain. J Mol Biol. 2007 Feb 16;366(2):504-16. Epub 2006 Nov 11. [PubMed:17157876]
  7. Cao H, Hegele RA: DNA polymorphism and mutations in CPN1, including the genomic basis of carboxypeptidase N deficiency. J Hum Genet. 2003;48(1):20-2. [PubMed:12560874]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB12271ORE-1001investigationalunknownDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails