Potassium voltage-gated channel subfamily A member 3

Details

Name
Potassium voltage-gated channel subfamily A member 3
Synonyms
  • HGK5
  • HLK3
  • HPCN3
  • Voltage-gated K(+) channel HuKIII
  • Voltage-gated potassium channel subunit Kv1.3
Gene Name
KCNA3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008567|Potassium voltage-gated channel subfamily A member 3
MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDH
LLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLK
TLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIF
SEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNSTSGSRAGASSFSDPFFVVET
LCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSL
AILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE
ADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIV
SNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHS
AFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
Number of residues
575
Molecular Weight
63841.09
Theoretical pI
Not Available
GO Classification
Functions
delayed rectifier potassium channel activity / voltage-gated ion channel activity
Processes
potassium ion transmembrane transport / potassium ion transport / protein homooligomerization / synaptic transmission
Components
axon / integral component of membrane / plasma membrane / voltage-gated potassium channel complex
General Function
Voltage-gated ion channel activity
Specific Function
Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.
Pfam Domain Function
Transmembrane Regions
235-253 295-316 328-348 363-381 398-417 459-481
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0013277|Potassium voltage-gated channel subfamily A member 3 (KCNA3)
ATGGACGAGCGCCTCAGCCTTCTGCGCTCGCCGCCGCCGCCCTCAGCCCGCCACCGCGCC
CACCCTCCTCAGCGCCCAGCGAGCAGCGGCGGTGCCCACACGCTGGTGAACCACGGCTAC
GCGGAGCCCGCCGCAGGCCGCGAGCTGCCGCCCGACATGACCGTGGTGCCCGGGGACCAC
CTGCTGGAGCCGGAGGTGGCCGATGGTGGAGGGGCCCCGCCTCAAGGCGGCTGTGGCGGC
GGCGGCTGCGACCGCTACGAGCCGCTGCCGCCCTCACTGCCGGCCGCGGGCGAGCAGGAC
TGCTGCGGGGAGCGCGTGGTCATCAACATCTCCGGGCTGCGCTTCGAGACGCAGCTGAAG
ACCCTTTGCCAGTTCCCCGAGACGCTGCTGGGCGACCCCAAGCGGCGCATGAGGTACTTC
GACCCGCTCCGCAACGAGTACTTCTTCGACCGCAACCGGCCCAGCTTCGACGCCATCCTC
TACTACTATCAGTCCGGGGGCCGCATCCGCCGGCCGGTCAACGTGCCCATCGACATTTTC
TCCGAGGAGATCCGCTTCTACCAGCTGGGCGAGGAGGCCATGGAGAAGTTCCGCGAGGAC
GAGGGCTTCCTGCGGGAGGAGGAGCGGCCCTTGCCCCGCCGCGACTTCCAGCGCCAGGTG
TGGCTGCTCTTCGAGTACCCCGAGAGCTCCGGGCCGGCCCGGGGCATCGCCATCGTGTCC
GTGCTGGTCATCCTCATCTCCATTGTCATCTTCTGCCTGGAGACGCTGCCGGAGTTCCGC
GACGAGAAGGACTACCCCGCCTCGACGTCGCAGGACTCATTCGAAGCAGCCGGCAACAGC
ACGTCGGGGTCCCGCGCAGGAGCCTCCAGCTTCTCCGATCCCTTCTTCGTGGTGGAGACG
CTGTGCATCATCTGGTTCTCCTTCGAACTGCTGGTGCGGTTCTTCGCTTGTCCTAGCAAA
GCCACCTTCTCGCGAAACATCATGAACCTGATCGACATTGTGGCCATCATTCCTTATTTT
ATCACTCTGGGTACCGAGCTGGCCGAACGACAGGGCAATGGACAGCAGGCCATGTCTCTG
GCCATCCTGAGGGTCATCCGCCTGGTAAGGGTCTTCCGCATCTTCAAGCTGTCGCGCCAC
TCCAAGGGGCTGCAGATCCTCGGGCAAACGCTGAAGGCGTCCATGCGGGAGCTGGGATTG
CTCATCTTCTTCCTCTTTATTGGGGTCATCCTTTTCTCCAGCGCGGTCTACTTTGCCGAG
GCAGACGACCCCACTTCAGGTTTCAGCAGCATCCCGGATGCCTTCTGGTGGGCAGTGGTA
ACCATGACAACAGTGGGTTACGGCGATATGCACCCAGTGACCATAGGGGGCAAGATTGTG
GGATCTCTCTGTGCCATCGCCGGTGTCTTGACCATCGCATTGCCAGTTCCCGTGATTGTT
TCCAACTTCAATTACTTCTACCACCGGGAGACAGAAGGGGAAGAGCAATCCCAGTACATG
CACGTGGGAAGTTGCCAGCACCTCTCCTCTTCAGCCGAGGAGCTCCGAAAAGCAAGGAGT
AACTCGACTCTGAGTAAGTCGGAGTATATGGTGATCGAAGAGGGGGGTATGAACCATAGC
GCTTTCCCCCAGACCCCTTTCAAAACGGGCAATTCCACTGCCACCTGCACCACGAACAAT
AATCCCAACTCTTGTGTCAACATCAAAAAGATATTCACCGATGTTTAA
Chromosome Location
1
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP22001
UniProtKB Entry NameKCNA3_HUMAN
HGNC IDHGNC:6221
General References
  1. Folander K, Douglass J, Swanson R: Confirmation of the assignment of the gene encoding Kv1.3, a voltage-gated potassium channel (KCNA3) to the proximal short arm of human chromosome 1. Genomics. 1994 Sep 1;23(1):295-6. [PubMed:7829094]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Philipson LH, Hice RE, Schaefer K, LaMendola J, Bell GI, Nelson DJ, Steiner DF: Sequence and functional expression in Xenopus oocytes of a human insulinoma and islet potassium channel. Proc Natl Acad Sci U S A. 1991 Jan 1;88(1):53-7. [PubMed:1986382]
  5. Attali B, Romey G, Honore E, Schmid-Alliana A, Mattei MG, Lesage F, Ricard P, Barhanin J, Lazdunski M: Cloning, functional expression, and regulation of two K+ channels in human T lymphocytes. J Biol Chem. 1992 Apr 25;267(12):8650-7. [PubMed:1373731]
  6. Cai YC, Osborne PB, North RA, Dooley DC, Douglass J: Characterization and functional expression of genomic DNA encoding the human lymphocyte type n potassium channel. DNA Cell Biol. 1992 Mar;11(2):163-72. [PubMed:1547020]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB06637DalfampridineapprovedyesantagonistDetails