Neuronal acetylcholine receptor subunit beta-4

Details

Name
Neuronal acetylcholine receptor subunit beta-4
Synonyms
Not Available
Gene Name
CHRNB4
Organism
Humans
Amino acid sequence
>lcl|BSEQ0006901|Neuronal acetylcholine receptor subunit beta-4
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQL
SLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNN
ADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTE
IDMVLMTPTASMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLI
IPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLM
FTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRPGPDSSPARAF
PPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRF
RQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLP
PLFQTHAASEGPYAAQRD
Number of residues
498
Molecular Weight
56378.985
Theoretical pI
8.45
GO Classification
Functions
acetylcholine binding / acetylcholine receptor activity / acetylcholine-activated cation-selective channel activity / drug binding / ligand-gated ion channel activity
Processes
action potential / behavioral response to nicotine / cation transmembrane transport / ion transmembrane transport / ion transport / locomotory behavior / neurological system process / positive regulation of transmission of nerve impulse / protein heterooligomerization / regulation of membrane potential / regulation of neurotransmitter secretion / regulation of smooth muscle contraction / response to nicotine / signal transduction / smooth muscle contraction / synaptic transmission / synaptic transmission involved in micturition / synaptic transmission, cholinergic
Components
acetylcholine-gated channel complex / cell junction / integral component of membrane / integral component of plasma membrane / neuron projection / plasma membrane / postsynaptic membrane / synapse
General Function
Ligand-gated ion channel activity
Specific Function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Pfam Domain Function
Transmembrane Regions
237-257 266-286 299-319 461-481
Cellular Location
Cell junction
Gene sequence
>lcl|BSEQ0020698|Neuronal acetylcholine receptor subunit beta-4 (CHRNB4)
ATGAGGCGCGCGCCTTCCCTGGTCCTTTTCTTCCTGGTCGCCCTTTGCGGGCGCGGGAAC
TGCCGCGTGGCCAATGCGGAGGAAAAGCTGATGGACGACCTTCTGAACAAAACCCGTTAC
AATAACCTGATCCGCCCAGCCACCAGCTCCTCACAGCTCATCTCCATCAAGCTGCAGCTC
TCCCTGGCCCAGCTTATCAGCGTGAATGAGCGAGAGCAGATCATGACCACCAATGTCTGG
CTGAAACAGGAATGGACTGATTACCGCCTGACCTGGAACAGCTCCCGCTACGAGGGTGTG
AACATCCTGAGGATCCCTGCAAAGCGCATCTGGTTGCCTGACATCGTGCTTTACAACAAC
GCCGACGGGACCTATGAGGTGTCTGTCTACACCAACTTGATAGTCCGGTCCAACGGCAGC
GTCCTGTGGCTGCCCCCTGCCATCTACAAGAGCGCCTGCAAGATTGAGGTGAAGTACTTT
CCCTTCGACCAGCAGAACTGCACCCTCAAGTTCCGCTCCTGGACCTATGACCACACGGAG
ATAGACATGGTCCTCATGACGCCCACAGCCAGCATGGATGACTTTACTCCCAGTGGTGAG
TGGGACATAGTGGCCCTCCCAGGGAGAAGGACAGTGAACCCACAAGACCCCAGCTACGTG
GACGTGACTTACGACTTCATCATCAAGCGCAAGCCTCTGTTCTACACCATCAACCTCATC
ATCCCCTGCGTGCTCACCACCTTGCTGGCCATCCTCGTCTTCTACCTGCCATCCGACTGC
GGCGAGAAGATGACACTGTGCATCTCAGTGCTGCTGGCACTGACATTCTTCCTGCTGCTC
ATCTCCAAGATCGTGCCACCCACCTCCCTCGATGTGCCTCTCATCGGCAAGTACCTCATG
TTCACCATGGTGCTGGTCACCTTCTCCATCGTCACCAGCGTCTGTGTGCTCAATGTGCAC
CACCGCTCGCCCAGCACCCACACCATGGCACCCTGGGTCAAGCGCTGCTTCCTGCACAAG
CTGCCTACCTTCCTCTTCATGAAGCGCCCTGGCCCCGACAGCAGCCCGGCCAGAGCCTTC
CCGCCCAGCAAGTCATGCGTGACCAAGCCCGAGGCCACCGCCACCTCCACCAGCCCCTCC
AACTTCTATGGGAACTCCATGTACTTTGTGAACCCCGCCTCTGCAGCTTCCAAGTCTCCA
GCCGGCTCTACCCCGGTGGCTATCCCCAGGGATTTCTGGCTGCGGTCCTCTGGGAGGTTC
CGACAGGATGTGCAGGAGGCATTAGAAGGTGTCAGCTTCATCGCCCAGCACATGAAGAAT
GACGATGAAGACCAGAGTGTCGTTGAGGACTGGAAGTACGTGGCTATGGTGGTGGACCGG
CTGTTCCTGTGGGTGTTCATGTTTGTGTGCGTCCTGGGCACTGTGGGGCTCTTCCTACCG
CCCCTCTTCCAGACCCATGCAGCTTCTGAGGGGCCCTACGCTGCCCAGCGTGACTGA
Chromosome Location
15
Locus
15q24
External Identifiers
ResourceLink
UniProtKB IDP30926
UniProtKB Entry NameACHB4_HUMAN
GenBank Protein ID1458126
GenBank Gene IDU62439
HGNC IDHGNC:1964
General References
  1. Elliott KJ, Ellis SB, Berckhan KJ, Urrutia A, Chavez-Noriega LE, Johnson EC, Velicelebi G, Harpold MM: Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits. J Mol Neurosci. 1996 Fall;7(3):217-28. [PubMed:8906617]
  2. Gerzanich V, Kuryatov A, Anand R, Lindstrom J: "Orphan" alpha6 nicotinic AChR subunit can form a functional heteromeric acetylcholine receptor. Mol Pharmacol. 1997 Feb;51(2):320-7. [PubMed:9203638]
  3. Groot Kormelink PJ, Luyten WH: Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32. FEBS Lett. 1997 Jan 6;400(3):309-14. [PubMed:9009220]
  4. Lev-Lehman E, Bercovich D, Xu W, Stockton DW, Beaudet AL: Characterization of the human beta4 nAChR gene and polymorphisms in CHRNA3 and CHRNB4. J Hum Genet. 2001;46(7):362-6. [PubMed:11450844]
  5. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Valor LM, Campos-Caro A, Carrasco-Serrano C, Ortiz JA, Ballesta JJ, Criado M: Transcription factors NF-Y and Sp1 are important determinants of the promoter activity of the bovine and human neuronal nicotinic receptor beta 4 subunit genes. J Biol Chem. 2002 Mar 15;277(11):8866-76. Epub 2001 Dec 12. [PubMed:11742001]
  8. Tarroni P, Rubboli F, Chini B, Zwart R, Oortgiesen M, Sher E, Clementi F: Neuronal-type nicotinic receptors in human neuroblastoma and small-cell lung carcinoma cell lines. FEBS Lett. 1992 Nov 2;312(1):66-70. [PubMed:1330682]
  9. Lansdell SJ, Gee VJ, Harkness PC, Doward AI, Baker ER, Gibb AJ, Millar NS: RIC-3 enhances functional expression of multiple nicotinic acetylcholine receptor subtypes in mammalian cells. Mol Pharmacol. 2005 Nov;68(5):1431-8. Epub 2005 Aug 24. [PubMed:16120769]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00184NicotineapprovedunknownagonistDetails
DB01227Levacetylmethadolapproved, investigationalunknownother/unknownDetails
DB01090PentoliniumapprovedyesantagonistDetails
DB00514DextromethorphanapprovedunknownantagonistDetails
DB00898EthanolapprovedunknownDetails
DB07720EpibatidineexperimentalunknownagonistDetails
DB00472Fluoxetineapproved, vet_approvedunknownantagonistDetails
DB00237Butabarbitalapproved, illicitunknowninhibitorDetails