Sodium/calcium exchanger 1

Details

Name
Sodium/calcium exchanger 1
Synonyms
  • CNC
  • Na(+)/Ca(2+)-exchange protein 1
  • NCX1
  • Solute carrier family 8 member 1
Gene Name
SLC8A1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001963|Sodium/calcium exchanger 1
MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGVI
LPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNG
ETTKTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMF
IIIALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVISPGVVEVWEGLLTFF
FFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPSSKTEIEMDGKVVNSHV
ENFLDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELANYQVLSQQQKS
RAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE
NCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGII
DDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIF
TFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQND
EIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLFGQPV
FRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESY
EFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHF
LTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVF
VALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQF
KVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSCLFVLLWLLYIF
FSSLEAYCHIKGF
Number of residues
973
Molecular Weight
108546.06
Theoretical pI
4.64
GO Classification
Functions
ankyrin binding / calcium / calcium ion binding / cytoskeletal protein binding / ion channel binding
Processes
blood coagulation / calcium ion export / calcium ion homeostasis / calcium ion import / calcium ion transmembrane transport / calcium ion transport into cytosol / cardiac muscle cell development / cardiac muscle contraction / cell communication by electrical coupling involved in cardiac conduction / cellular response to caffeine / cellular response to cAMP / cellular response to hypoxia / cellular response to reactive oxygen species / cellular sodium ion homeostasis / cytosolic calcium ion transport / embryonic heart tube development / embryonic placenta development / heart morphogenesis / ion transport / membrane depolarization during cardiac muscle cell action potential / muscle contraction / muscle fiber development / negative regulation of cytosolic calcium ion concentration / positive regulation of bone mineralization / positive regulation of fibroblast migration / positive regulation of the force of heart contraction / post-embryonic development / regulation of cardiac muscle contraction by calcium ion signaling / regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion / regulation of cell communication by electrical coupling / regulation of heart rate / regulation of sodium ion transport / regulation of the force of heart contraction / relaxation of cardiac muscle / relaxation of smooth muscle / response to ATP / response to drug / response to glucose / response to hydrogen peroxide / response to immobilization stress / response to muscle stretch / response to nutrient / sodium ion export / sodium ion import / sodium ion transmembrane transport / telencephalon development / transmembrane transport / vascular smooth muscle contraction
Components
basolateral plasma membrane / cytosol / dendritic shaft / dendritic spine / integral component of plasma membrane / intercalated disc / microtubule / mitochondrion / plasma membrane / sarcolemma / T-tubule / Z disc
General Function
Ion channel binding
Specific Function
Mediates the exchange of one Ca(2+) ion against three to four Na(+) ions across the cell membrane, and thereby contributes to the regulation of cytoplasmic Ca(2+) levels and Ca(2+)-dependent cellular processes (PubMed:1374913, PubMed:11241183, PubMed:1476165). Contributes to Ca(2+) transport during excitation-contraction coupling in muscle. In a first phase, voltage-gated channels mediate the rapid increase of cytoplasmic Ca(2+) levels due to release of Ca(2+) stores from the endoplasmic reticulum. SLC8A1 mediates the export of Ca(2+) from the cell during the next phase, so that cytoplasmic Ca(2+) levels rapidly return to baseline. Required for normal embryonic heart development and the onset of heart contractions.
Pfam Domain Function
Transmembrane Regions
75-95 137-157 171-191 205-225 232-252 801-821 825-845 875-895 907-927 945-965
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016275|Sodium/calcium exchanger 1 (SLC8A1)
ATGTACAACATGCGGCGATTAAGTCTTTCACCCACCTTTTCAATGGGATTTCATCTGTTA
GTTACTGTGAGTCTCTTATTTTCCCATGTGGACCATGTAATTGCTGAGACAGAAATGGAA
GGAGAAGGAAATGAAACTGGTGAATGTACTGGATCATATTACTGTAAGAAAGGGGTGATT
TTGCCCATTTGGGAACCCCAAGACCCTTCTTTTGGGGACAAAATTGCTAGAGCTACTGTG
TATTTTGTGGCCATGGTCTACATGTTTCTTGGAGTCTCTATCATAGCTGATCGGTTCATG
TCCTCTATAGAAGTCATCACATCTCAAGAAAAAGAAATAACCATAAAGAAACCCAATGGA
GAGACCACCAAGACAACTGTGAGGATCTGGAATGAAACAGTTTCTAACCTGACCTTGATG
GCCCTGGGATCTTCTGCTCCTGAGATTCTCCTTTCAGTAATTGAAGTGTGTGGCCATAAC
TTCACTGCAGGAGACCTCGGTCCTAGCACCATCGTGGGAAGTGCTGCATTCAATATGTTC
ATCATTATTGCACTCTGTGTTTATGTGGTGCCTGACGGAGAGACAAGGAAGATTAAGCAT
TTGCGTGTCTTCTTTGTGACAGCAGCCTGGAGCATCTTTGCCTACACCTGGCTTTACATT
ATTTTGTCTGTCATATCTCCTGGTGTTGTGGAGGTCTGGGAAGGTTTGCTTACTTTCTTC
TTCTTTCCCATCTGTGTTGTGTTCGCTTGGGTAGCGGATAGGAGACTTCTGTTTTACAAG
TATGTCTACAAGAGGTATCGAGCTGGCAAGCAGAGGGGGATGATTATTGAACATGAAGGA
GACAGGCCATCTTCTAAGACTGAAATTGAAATGGACGGGAAAGTGGTCAATTCTCATGTT
GAAAATTTCTTAGATGGTGCTCTGGTTCTGGAGGTGGATGAGAGGGACCAAGATGATGAA
GAAGCTAGGCGAGAAATGGCTAGGATTCTGAAGGAACTTAAGCAGAAGCATCCAGATAAA
GAAATAGAGCAATTAATAGAATTAGCTAACTACCAAGTCCTAAGTCAGCAGCAAAAAAGT
AGAGCATTTTATCGCATTCAAGCTACTCGCCTCATGACTGGAGCTGGCAACATTTTAAAG
AGGCATGCAGCTGACCAAGCAAGGAAGGCTGTCAGCATGCACGAGGTCAACACTGAAGTG
ACTGAAAATGACCCTGTTAGTAAGATCTTCTTTGAACAAGGGACATATCAGTGTCTGGAG
AACTGTGGTACTGTGGCCCTTACCATTATCCGCAGAGGTGGTGATTTGACTAACACTGTG
TTTGTTGACTTCAGAACAGAGGATGGCACAGCAAATGCTGGGTCTGATTATGAATTTACT
GAAGGAACTGTGGTGTTTAAGCCTGGTGATACCCAGAAGGAAATCAGAGTGGGTATCATA
GATGATGATATCTTTGAGGAGGATGAAAATTTCCTTGTGCATCTCAGCAATGTCAAAGTA
TCTTCTGAAGCTTCAGAAGATGGCATACTGGAAGCCAATCATGTTTCTACACTTGCTTGC
CTCGGATCTCCCTCCACTGCCACTGTAACTATTTTTGATGATGACCACGCAGGCATTTTT
ACTTTTGAGGAACCTGTGACTCATGTGAGTGAGAGCATTGGCATCATGGAGGTGAAAGTA
TTGAGAACATCTGGAGCTCGAGGAAATGTTATCGTTCCATATAAAACCATCGAAGGGACT
GCCAGAGGTGGAGGGGAGGATTTTGAGGACACTTGTGGAGAGCTCGAATTCCAGAATGAT
GAAATTGTCAAAACAATATCAGTCAAGGTAATTGATGATGAGGAGTATGAGAAAAACAAG
ACCTTCTTCCTTGAGATTGGAGAGCCCCGCCTGGTGGAGATGAGTGAGAAGAAAGCCCTG
TTATTGAATGAGCTTGGTGGCTTCACAATAACAGGCCAACCTGTCTTCAGGAAGGTTCAT
GCTAGAGAACATCCGATTCTCTCTACTGTAATCACCATTGCAGACGAATATGATGACAAG
CAGCCACTGACCAGCAAAGAGGAAGAGGAGAGGCGCATTGCAGAAATGGGGCGCCCCATC
CTGGGAGAGCACACCAAGTTGGAAGTGATCATTGAAGAATCCTATGAATTCAAGAGTACT
GTGGACAAACTCATTAAGAAGACAAACCTGGCCCTTGTGGTTGGGACTAACAGCTGGAGA
GAACAGTTCATTGAAGCTATCACTGTCAGTGCTGGGGAAGATGATGACGACGATGAATGT
GGGGAAGAGAAGCTGCCCTCCTGTTTCGATTACGTGATGCACTTTCTGACTGTGTTCTGG
AAGGTCCTGTTTGCCTTCGTCCCCCCTACTGAATACTGGAATGGCTGGGCGTGTTTCATT
GTCTCCATCCTCATGATTGGCCTACTGACAGCTTTCATTGGAGACCTGGCTTCCCACTTT
GGCTGCACCATTGGCCTGAAAGATTCTGTGACTGCAGTCGTGTTCGTCGCACTTGGAACA
TCAGTGCCAGACACATTTGCCAGCAAAGTGGCAGCCACCCAGGACCAGTATGCAGACGCC
TCCATAGGTAACGTCACGGGCAGCAACGCGGTGAATGTCTTCCTGGGAATCGGTGTGGCC
TGGTCCATCGCTGCCATCTACCACGCAGCCAATGGGGAACAGTTCAAAGTGTCCCCTGGC
ACACTAGCTTTCTCTGTCACTCTCTTCACCATTTTTGCTTTCATCAATGTGGGGGTGCTG
CTGTATCGGCGGAGGCCAGAAATCGGAGGTGAGCTGGGTGGGCCCCGGACTGCCAAGCTC
CTCACATCCTGCCTCTTTGTGCTCCTATGGCTCTTGTACATTTTCTTCTCCTCCCTGGAG
GCCTACTGCCACATAAAAGGCTTCTAA
Chromosome Location
2
Locus
2p23-p22
External Identifiers
ResourceLink
UniProtKB IDP32418
UniProtKB Entry NameNAC1_HUMAN
GenBank Protein ID180673
GenBank Gene IDM91368
GenAtlas IDSLC8A1
HGNC IDHGNC:11068
General References
  1. Komuro I, Wenninger KE, Philipson KD, Izumo S: Molecular cloning and characterization of the human cardiac Na+/Ca2+ exchanger cDNA. Proc Natl Acad Sci U S A. 1992 May 15;89(10):4769-73. [PubMed:1374913]
  2. Van Eylen F, Bollen A, Herchuelz A: NCX1 Na/Ca exchanger splice variants in pancreatic islet cells. J Endocrinol. 2001 Mar;168(3):517-26. [PubMed:11241183]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  5. Lundquist P, Lundgren T, Gritli-Linde A, Linde A: Na+/Ca2+ exchanger isoforms of rat odontoblasts and osteoblasts. Calcif Tissue Int. 2000 Jul;67(1):60-7. [PubMed:10908415]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Loo TW, Clarke DM: Functional expression of human renal Na+/Ca2+ exchanger in insect cells. Am J Physiol. 1994 Jul;267(1 Pt 2):F70-4. [PubMed:8048567]
  8. Kofuji P, Hadley RW, Kieval RS, Lederer WJ, Schulze DH: Expression of the Na-Ca exchanger in diverse tissues: a study using the cloned human cardiac Na-Ca exchanger. Am J Physiol. 1992 Dec;263(6 Pt 1):C1241-9. [PubMed:1476165]
  9. Ren X, Philipson KD: The topology of the cardiac Na(+)/Ca(2)(+) exchanger, NCX1. J Mol Cell Cardiol. 2013 Apr;57:68-71. doi: 10.1016/j.yjmcc.2013.01.010. Epub 2013 Jan 31. [PubMed:23376057]
  10. Khananshvili D: The SLC8 gene family of sodium-calcium exchangers (NCX) - structure, function, and regulation in health and disease. Mol Aspects Med. 2013 Apr-Jun;34(2-3):220-35. doi: 10.1016/j.mam.2012.07.003. [PubMed:23506867]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00132alpha-Linolenic acidapproved, investigational, nutraceuticalunknownDetails
DB00159Icosapentapproved, nutraceuticalyesinhibitorDetails
DB06231CaldaretinvestigationalunknownDetails
DB11093Calcium citrateapproved, investigationalnosubstrateDetails
DB11348Calcium PhosphateapprovednosubstrateDetails
DB09498Strontium chloride Sr-89approved, investigationalnoinducerDetails
DB14481Calcium phosphate dihydrateapprovednoDetails
DB04855DronedaroneapprovedyesinhibitorDetails