Prostaglandin E2 receptor EP4 subtype

Details

Name
Prostaglandin E2 receptor EP4 subtype
Synonyms
  • PGE receptor EP4 subtype
  • Prostanoid EP4 receptor
  • PTGER2
Gene Name
PTGER4
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012453|Prostaglandin E2 receptor EP4 subtype
MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI
Number of residues
488
Molecular Weight
53118.845
Theoretical pI
8.91
GO Classification
Functions
prostaglandin E receptor activity
Processes
adenylate cyclase-modulating G-protein coupled receptor signaling pathway / bone development / cellular response to mechanical stimulus / ERK1 and ERK2 cascade / immune response / JNK cascade / negative regulation of cytokine secretion / negative regulation of eosinophil extravasation / negative regulation of inflammatory response / negative regulation of integrin activation / positive regulation of cytokine secretion / positive regulation of inflammatory response / regulation of ossification / regulation of stress fiber assembly / response to lipopolysaccharide / response to mechanical stimulus / T-helper cell differentiation
Components
integral component of membrane / intracellular / plasma membrane
General Function
Prostaglandin e receptor activity
Specific Function
Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.
Pfam Domain Function
Transmembrane Regions
20-43 56-79 97-115 136-160 185-211 268-295 313-332
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0012454|Prostaglandin E2 receptor EP4 subtype (PTGER4)
ATGTCCACTCCCGGGGTCAATTCGTCCGCCTCCTTGAGCCCCGACCGGCTGAACAGCCCA
GTGACCATCCCGGCGGTGATGTTCATCTTCGGGGTGGTGGGCAACCTGGTGGCCATCGTG
GTGCTGTGCAAGTCGCGCAAGGAGCAGAAGGAGACGACCTTCTACACGCTGGTATGTGGG
CTGGCTGTCACCGACCTGTTGGGCACTTTGTTGGTGAGCCCGGTGACCATCGCCACGTAC
ATGAAGGGCCAATGGCCCGGGGGCCAGCCGCTGTGCGAGTACAGCACCTTCATTCTGCTC
TTCTTCAGCCTGTCCGGCCTCAGCATCATCTGCGCCATGAGTGTCGAGCGCTACCTGGCC
ATCAACCATGCCTATTTCTACAGCCACTACGTGGACAAGCGATTGGCGGGCCTCACGCTC
TTTGCAGTCTATGCGTCCAACGTGCTCTTTTGCGCGCTGCCCAACATGGGTCTCGGTAGC
TCGCGGCTGCAGTACCCAGACACCTGGTGCTTCATCGACTGGACCACCAACGTGACGGCG
CACGCCGCCTACTCCTACATGTACGCGGGCTTCAGCTCCTTCCTCATTCTCGCCACCGTC
CTCTGCAACGTGCTTGTGTGCGGCGCGCTGCTCCGCATGCACCGCCAGTTCATGCGCCGC
ACCTCGCTGGGCACCGAGCAGCACCACGCGGCCGCGGCCGCCTCGGTTGCCTCCCGGGGC
CACCCCGCTGCCTCCCCAGCCTTGCCGCGCCTCAGCGACTTTCGGCGCCGCCGGAGCTTC
CGCCGCATCGCGGGCGCCGAGATCCAGATGGTCATCTTACTCATTGCCACCTCCCTGGTG
GTGCTCATCTGCTCCATCCCGCTCGTGGTGCGAGTATTCGTCAACCAGTTATATCAGCCA
AGTTTGGAGCGAGAAGTCAGTAAAAATCCAGATTTGCAGGCCATCCGAATTGCTTCTGTG
AACCCCATCCTAGACCCCTGGATATATATCCTCCTGAGAAAGACAGTGCTCAGTAAAGCA
ATAGAGAAGATCAAATGCCTCTTCTGCCGCATTGGCGGGTCCCGCAGGGAGCGCTCCGGA
CAGCACTGCTCAGACAGTCAAAGGACATCTTCTGCCATGTCAGGCCACTCTCGCTCCTTC
ATCTCCCGGGAGCTGAAGGAGATCAGCAGTACATCTCAGACCCTCCTGCCAGACCTCTCA
CTGCCAGACCTCAGTGAAAATGGCCTTGGAGGCAGGAATTTGCTTCCAGGTGTGCCTGGC
ATGGGCCTGGCCCAGGAAGACACCACCTCACTGAGGACTTTGCGAATATCAGAGACCTCA
GACTCTTCACAGGGTCAGGACTCAGAGAGTGTCTTACTGGTGGATGAGGCTGGTGGGAGC
GGCAGGGCTGGGCCTGCCCCTAAGGGGAGCTCCCTGCAAGTCACATTTCCCAGTGAAACA
CTGAACTTATCAGAAAAATGTATATAA
Chromosome Location
5
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP35408
UniProtKB Entry NamePE2R4_HUMAN
GenBank Gene IDBC113523
GenAtlas IDPTGER4
HGNC IDHGNC:9596
General References
  1. Bastien L, Sawyer N, Grygorczyk R, Metters KM, Adam M: Cloning, functional expression, and characterization of the human prostaglandin E2 receptor EP2 subtype. J Biol Chem. 1994 Apr 22;269(16):11873-7. [PubMed:8163486]
  2. An S, Yang J, Xia M, Goetzl EJ: Cloning and expression of the EP2 subtype of human receptors for prostaglandin E2. Biochem Biophys Res Commun. 1993 Nov 30;197(1):263-70. [PubMed:8250933]
  3. Foord SM, Marks B, Stolz M, Bufflier E, Fraser NJ, Lee MG: The structure of the prostaglandin EP4 receptor gene and related pseudogenes. Genomics. 1996 Jul 1;35(1):182-8. [PubMed:8661119]
  4. Mori K, Tanaka I, Kotani M, Miyaoka F, Sando T, Muro S, Sasaki Y, Nakagawa O, Ogawa Y, Usui T, Ozaki S, Ichikawa A, Narumiya S, Nakao K: Gene expression of the human prostaglandin E receptor EP4 subtype: differential regulation in monocytoid and lymphoid lineage cells by phorbol ester. J Mol Med (Berl). 1996 Jun;74(6):333-6. [PubMed:8862514]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Slipetz D, Buchanan S, Mackereth C, Brewer N, Pellow V, Hao C, Adam M, Abramovitz M, Metters KM: Sequestration and phosphorylation of the prostaglandin E2 EP4 receptor: dependence on the C-terminal tail. Biochem Pharmacol. 2001 Oct 15;62(8):997-1012. [PubMed:11597569]
  7. Neuschafer-Rube F, Hermosilla R, Rehwald M, Ronnstrand L, Schulein R, Wernstedt C, Puschel GP: Identification of a Ser/Thr cluster in the C-terminal domain of the human prostaglandin receptor EP4 that is essential for agonist-induced beta-arrestin1 recruitment but differs from the apparent principal phosphorylation site. Biochem J. 2004 May 1;379(Pt 3):573-85. [PubMed:14709160]
  8. Takayama K, Sukhova GK, Chin MT, Libby P: A novel prostaglandin E receptor 4-associated protein participates in antiinflammatory signaling. Circ Res. 2006 Mar 3;98(4):499-504. Epub 2006 Jan 19. [PubMed:16424369]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00917DinoprostoneapprovedyesagonistDetails
DB00929MisoprostolapprovedunknownagonistDetails
DB09211LimaprostinvestigationalunknownDetails
DB11113Castor oilapproved, investigational, nutraceutical, vet_approvedunknownagonistDetails
DB12836Grapiprantinvestigational, vet_approvedyesantagonistDetails