Aryl hydrocarbon receptor

Details

Name
Aryl hydrocarbon receptor
Synonyms
  • Ah receptor
  • BHLHE76
  • Class E basic helix-loop-helix protein 76
Gene Name
AHR
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017202|Aryl hydrocarbon receptor
MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQ
ALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNP
SQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQ
GKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC
DAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRW
TWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF
PAIMDPLPLRTKNGTSGKDSATTSTLSKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAP
FENNFFNESMNECRNWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLY
SIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQ
QQQSLALNSSCMVQEHLHLEQQQQHHQKQVVVEPQQQLCQKMKHMQVNGMFENWNSNQFV
PFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNFISCNQPVLPQHSKCTELDYP
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQH
THVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFP
DLTSSGFL
Number of residues
848
Molecular Weight
96146.705
Theoretical pI
6.34
GO Classification
Functions
DNA binding / E-box binding / enhancer binding / Hsp90 protein binding / protein dimerization activity / protein heterodimerization activity / RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding / sequence-specific DNA binding / transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding / transcription factor activity, sequence-specific DNA binding / transcription factor binding / transcription regulatory region DNA binding
Processes
apoptotic process / blood vessel development / cell cycle / circadian regulation of gene expression / intracellular receptor signaling pathway / negative regulation of transcription from RNA polymerase II promoter / negative regulation of transcription, DNA-templated / positive regulation of RNA polymerase II transcriptional preinitiation complex assembly / positive regulation of transcription from RNA polymerase II promoter / positive regulation of transcription, DNA-templated / prostate gland development / regulation of B cell proliferation / regulation of gene expression / regulation of transcription from RNA polymerase II promoter / regulation of transcription, DNA-templated / response to toxic substance / response to xenobiotic stimulus / transcription from RNA polymerase II promoter / xenobiotic metabolic process
Components
cytoplasm / cytosolic aryl hydrocarbon receptor complex / nuclear aryl hydrocarbon receptor complex / nucleoplasm / nucleus / transcription factor complex
General Function
Transcription regulatory region dna binding
Specific Function
Ligand-activated transcriptional activator. Binds to the XRE promoter region of genes it activates. Activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Involved in cell-cycle regulation. Likely to play an important role in the development and maturation of many tissues. Regulates the circadian clock by inhibiting the basal and circadian expression of the core circadian component PER1. Inhibits PER1 by repressing the CLOCK-ARNTL/BMAL1 heterodimer mediated transcriptional activation of PER1.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0017203|Aryl hydrocarbon receptor (AHR)
ATGAACAGCAGCAGCGCCAACATCACCTACGCCAGTCGCAAGCGGCGGAAGCCGGTGCAG
AAAACAGTAAAGCCAATCCCAGCTGAAGGAATCAAGTCAAATCCTTCCAAGCGGCATAGA
GACCGACTTAATACAGAGTTGGACCGTTTGGCTAGCCTGCTGCCTTTCCCACAAGATGTT
ATTAATAAGTTGGACAAACTTTCAGTTCTTAGGCTCAGCGTCAGTTACCTGAGAGCCAAG
AGCTTCTTTGATGTTGCATTAAAATCCTCCCCTACTGAAAGAAACGGAGGCCAGGATAAC
TGTAGAGCAGCAAATTTCAGAGAAGGCCTGAACTTACAAGAAGGAGAATTCTTATTACAG
GCTCTGAATGGCTTTGTATTAGTTGTCACTACAGATGCTTTGGTCTTTTATGCTTCTTCT
ACTATACAAGATTATCTAGGGTTTCAGCAGTCTGATGTCATACATCAGAGTGTATATGAA
CTTATCCATACCGAAGACCGAGCTGAATTTCAGCGTCAGCTACACTGGGCATTAAATCCT
TCTCAGTGTACAGAGTCTGGACAAGGAATTGAAGAAGCCACTGGTCTCCCCCAGACAGTA
GTCTGTTATAACCCAGACCAGATTCCTCCAGAAAACTCTCCTTTAATGGAGAGGTGCTTC
ATATGTCGTCTAAGGTGTCTGCTGGATAATTCATCTGGTTTTCTGGCAATGAATTTCCAA
GGGAAGTTAAAGTATCTTCATGGACAGAAAAAGAAAGGGAAAGATGGATCAATACTTCCA
CCTCAGTTGGCTTTGTTTGCGATAGCTACTCCACTTCAGCCACCATCCATACTTGAAATC
CGGACCAAAAATTTTATCTTTAGAACCAAACACAAACTAGACTTCACACCTATTGGTTGT
GATGCCAAAGGAAGAATTGTTTTAGGATATACTGAAGCAGAGCTGTGCACGAGAGGCTCA
GGTTATCAGTTTATTCATGCAGCTGATATGCTTTATTGTGCCGAGTCCCATATCCGAATG
ATTAAGACTGGAGAAAGTGGCATGATAGTTTTCCGGCTTCTTACAAAAAACAACCGATGG
ACTTGGGTCCAGTCTAATGCACGCCTGCTTTATAAAAATGGAAGACCAGATTATATCATT
GTAACTCAGAGACCACTAACAGATGAGGAAGGAACAGAGCATTTACGAAAACGAAATACG
AAGTTGCCTTTTATGTTTACCACTGGAGAAGCTGTGTTGTATGAGGCAACCAACCCTTTT
CCTGCCATAATGGATCCCTTACCACTAAGGACTAAAAATGGCACTAGTGGAAAAGACTCT
GCTACCACATCCACTCTAAGCAAGGACTCTCTCAATCCTAGTTCCCTCCTGGCTGCCATG
ATGCAACAAGATGAGTCTATTTATCTCTATCCTGCTTCAAGTACTTCAAGTACTGCACCT
TTTGAAAACAACTTTTTCAACGAATCTATGAATGAATGCAGAAATTGGCAAGATAATACT
GCACCGATGGGAAATGATACTATCCTGAAACATGAGCAAATTGACCAGCCTCAGGATGTG
AACTCATTTGCTGGAGGTCACCCAGGGCTCTTTCAAGATAGTAAAAACAGTGACTTGTAC
AGCATAATGAAAAACCTAGGCATTGATTTTGAAGACATCAGACACATGCAGAATGAAAAA
TTTTTCAGAAATGATTTTTCTGGTGAGGTTGACTTCAGAGACATTGACTTAACGGATGAA
ATCCTGACGTATGTCCAAGATTCTTTAAGTAAGTCTCCCTTCATACCTTCAGATTATCAA
CAGCAACAGTCCTTGGCTCTGAACTCAAGCTGTATGGTACAGGAACACCTACATCTAGAA
CAGCAACAGCAACATCACCAAAAGCAAGTAGTAGTGGAGCCACAGCAACAGCTGTGTCAG
AAGATGAAGCACATGCAAGTTAATGGCATGTTTGAAAATTGGAACTCTAACCAATTCGTG
CCTTTCAATTGTCCACAGCAAGACCCACAACAATATAATGTCTTTACAGACTTACATGGG
ATCAGTCAAGAGTTCCCCTACAAATCTGAAATGGATTCTATGCCTTATACACAGAACTTT
ATTTCCTGTAATCAGCCTGTATTACCACAACATTCCAAATGTACAGAGCTGGACTACCCT
ATGGGGAGTTTTGAACCATCCCCATACCCCACTACTTCTAGTTTAGAAGATTTTGTCACT
TGTTTACAACTTCCTGAAAACCAAAAGCATGGATTAAATCCACAGTCAGCCATAATAACT
CCTCAGACATGTTATGCTGGGGCCGTGTCGATGTATCAGTGCCAGCCAGAACCTCAGCAC
ACCCACGTGGGTCAGATGCAGTACAATCCAGTACTGCCAGGCCAACAGGCATTTTTAAAC
AAGTTTCAGAATGGAGTTTTAAATGAAACATATCCAGCTGAATTAAATAACATAAATAAC
ACTCAGACTACCACACATCTTCAGCCACTTCATCATCCGTCAGAAGCCAGACCTTTTCCT
GATTTGACATCCAGTGGATTCCTGTAA
Chromosome Location
7
Locus
7p15
External Identifiers
ResourceLink
UniProtKB IDP35869
UniProtKB Entry NameAHR_HUMAN
GenBank Protein ID533324
GenBank Gene IDD16354
HGNC IDHGNC:348
General References
  1. Itoh S, Kamataki T: Human Ah receptor cDNA: analysis for highly conserved sequences. Nucleic Acids Res. 1993 Jul 25;21(15):3578. [PubMed:8393992]
  2. Dolwick KM, Schmidt JV, Carver LA, Swanson HI, Bradfield CA: Cloning and expression of a human Ah receptor cDNA. Mol Pharmacol. 1993 Nov;44(5):911-7. [PubMed:8246913]
  3. Ema M, Matsushita N, Sogawa K, Ariyama T, Inazawa J, Nemoto T, Ota M, Oshimura M, Fujii-Kuriyama Y: Human arylhydrocarbon receptor: functional expression and chromosomal assignment to 7p21. J Biochem. 1994 Oct;116(4):845-51. [PubMed:7883760]
  4. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205]
  5. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Bennett P, Ramsden DB, Williams AC: Complete structural characterisation of the human aryl hydrocarbon receptor gene. Clin Mol Pathol. 1996 Feb;49(1):M12-6. [PubMed:16696038]
  8. Hayashi S, Watanabe J, Nakachi K, Eguchi H, Gotoh O, Kawajiri K: Interindividual difference in expression of human Ah receptor and related P450 genes. Carcinogenesis. 1994 May;15(5):801-6. [PubMed:7515333]
  9. Ema M, Ohe N, Suzuki M, Mimura J, Sogawa K, Ikawa S, Fujii-Kuriyama Y: Dioxin binding activities of polymorphic forms of mouse and human arylhydrocarbon receptors. J Biol Chem. 1994 Nov 4;269(44):27337-43. [PubMed:7961644]
  10. Nguyen TA, Hoivik D, Lee JE, Safe S: Interactions of nuclear receptor coactivator/corepressor proteins with the aryl hydrocarbon receptor complex. Arch Biochem Biophys. 1999 Jul 15;367(2):250-7. [PubMed:10395741]
  11. Wolff S, Harper PA, Wong JM, Mostert V, Wang Y, Abel J: Cell-specific regulation of human aryl hydrocarbon receptor expression by transforming growth factor-beta(1). Mol Pharmacol. 2001 Apr;59(4):716-24. [PubMed:11259615]
  12. Puga A, Xia Y, Elferink C: Role of the aryl hydrocarbon receptor in cell cycle regulation. Chem Biol Interact. 2002 Sep 20;141(1-2):117-30. [PubMed:12213388]
  13. Antenos M, Casper RF, Brown TJ: Interaction with Nedd8, a ubiquitin-like protein, enhances the transcriptional activity of the aryl hydrocarbon receptor. J Biol Chem. 2002 Nov 15;277(46):44028-34. Epub 2002 Sep 4. [PubMed:12215427]
  14. Dunham EE, Stevens EA, Glover E, Bradfield CA: The aryl hydrocarbon receptor signaling pathway is modified through interactions with a Kelch protein. Mol Pharmacol. 2006 Jul;70(1):8-15. Epub 2006 Mar 31. [PubMed:16582008]
  15. Harper PA, Wong Jm, Lam MS, Okey AB: Polymorphisms in the human AH receptor. Chem Biol Interact. 2002 Sep 20;141(1-2):161-87. [PubMed:12213390]
  16. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. [PubMed:22814378]
  17. Kawajiri K, Watanabe J, Eguchi H, Nakachi K, Kiyohara C, Hayashi S: Polymorphisms of human Ah receptor gene are not involved in lung cancer. Pharmacogenetics. 1995 Jun;5(3):151-8. [PubMed:7550366]
  18. Smart J, Daly AK: Variation in induced CYP1A1 levels: relationship to CYP1A1, Ah receptor and GSTM1 polymorphisms. Pharmacogenetics. 2000 Feb;10(1):11-24. [PubMed:10739168]
  19. Cauchi S, Stucker I, Solas C, Laurent-Puig P, Cenee S, Hemon D, Jacquet M, Kremers P, Beaune P, Massaad-Massade L: Polymorphisms of human aryl hydrocarbon receptor (AhR) gene in a French population: relationship with CYP1A1 inducibility and lung cancer. Carcinogenesis. 2001 Nov;22(11):1819-24. [PubMed:11698344]
  20. Wong JM, Okey AB, Harper PA: Human aryl hydrocarbon receptor polymorphisms that result in loss of CYP1A1 induction. Biochem Biophys Res Commun. 2001 Nov 9;288(4):990-6. [PubMed:11689007]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01404Ginsengapproved, investigational, nutraceuticalunknownagonistDetails
DB01097Leflunomideapproved, investigationalunknownagonistDetails
DB00499Flutamideapproved, investigationalunknownagonistDetails
DB00393Nimodipineapproved, investigationalunknownagonistDetails
DB00379Mexiletineapproved, investigationalunknownagonistDetails
DB01076AtorvastatinapprovedunknownagonistDetails
DB06732beta-NaphthoflavoneexperimentalunknownDetails
DB12116Epigallocatechin gallateinvestigationalunknownDetails
DB11577Indigotindisulfonic AcidapprovedunknownDetails
DB12328Cantharidinapproved, investigationalunknownagonistDetails
DB08995Diosminapproved, investigationalunknownagonistDetails
DB07715EmodininvestigationalunknownagonistDetails
DB02052Indirubin-3'-MonoximeexperimentalunknownagonistDetails
DB12379IndirubininvestigationalunknownagonistDetails
DB02709Resveratrolapproved, experimental, investigationalunknownDetails
DB08624BENZOTHIAZOLEexperimentalunknownDetails
DB04216Quercetinexperimental, investigationalunknownDetails
DB11937Kynurenic AcidinvestigationalunknownDetails
DB00338Omeprazoleapproved, investigational, vet_approvedunknownagonistDetails