Excitatory amino acid transporter 3

Details

Name
Excitatory amino acid transporter 3
Synonyms
  • EAAC1
  • EAAT3
  • Excitatory amino-acid carrier 1
  • Neuronal and epithelial glutamate transporter
  • Sodium-dependent glutamate/aspartate transporter 3
  • Solute carrier family 1 member 1
Gene Name
SLC1A1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010739|Excitatory amino acid transporter 3
MGKPARKGCEWKRFLKNNWVLLSTVAAVVLGITTGVLVREHSNLSTLEKFYFAFPGEILM
RMLKLIILPLIISSMITGVAALDSNVSGKIGLRAVVYYFCTTLIAVILGIVLVVSIKPGV
TQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMT
EESFTAVMTTAISKNKTKEYKIVGMYSDGINVLGLIVFCLVFGLVIGKMGEKGQILVDFF
NALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWEIFRKLGLYMATVLTGLAIHSIVI
LPLIYFIVVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEENNQVDKRITRFVLP
VGATINMDGTALYEAVAAVFIAQLNDLDLGIGQIITISITATSASIGAAGVPQAGLVTMV
IVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVN
IVNPFALESTILDNEDSDTKKSYVNGGFAVDKSDTISFTQTSQF
Number of residues
524
Molecular Weight
57099.835
Theoretical pI
5.36
GO Classification
Functions
cysteine transmembrane transporter activity / glutamate / glutamate binding / L-glutamate transmembrane transporter activity / sodium
Processes
cysteine transmembrane transport / cysteine transport / D-aspartate import / glutamate secretion / ion transport / L-glutamate import / L-glutamate transmembrane transport / neurotransmitter secretion / positive regulation of heart rate / protein homooligomerization / synaptic transmission / transmembrane transport
Components
apical plasma membrane / extracellular exosome / integral component of plasma membrane / membrane / plasma membrane
General Function
Sodium:dicarboxylate symporter activity
Specific Function
Transports L-glutamate, L- and D-aspartate and L-cystein (PubMed:21123949). Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium. Negatively regulated by ARL6IP5 (By similarity).
Pfam Domain Function
Transmembrane Regions
19-38 62-82 94-114 210-229 254-273 290-309 316-335 362-381 392-411 420-439
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010740|Excitatory amino acid transporter 3 (SLC1A1)
ATGGGGAAACCGGCGAGGAAAGGATGCGAGTGGAAGCGCTTCCTGAAGAATAACTGGGTG
TTGCTGTCCACCGTGGCCGCGGTGGTGCTAGGCATTACCACAGGAGTCTTGGTTCGAGAA
CACAGCAACCTCTCAACTCTAGAGAAATTCTACTTTGCTTTTCCTGGAGAAATTCTAATG
CGGATGCTGAAACTCATCATTTTGCCATTAATTATATCCAGCATGATTACAGGTGTTGCT
GCACTGGATTCCAACGTATCCGGAAAAATTGGTCTGCGCGCTGTCGTGTATTATTTCTGT
ACCACTCTCATTGCTGTTATTCTAGGTATTGTGCTGGTGGTGAGCATCAAGCCTGGTGTC
ACCCAGAAAGTGGGTGAAATTGCGAGGACAGGCAGCACCCCTGAAGTCAGTACGGTGGAT
GCCATGTTAGATCTCATCAGGAATATGTTCCCTGAGAATCTTGTCCAGGCCTGTTTTCAG
CAGTACAAAACTAAGCGTGAAGAAGTGAAGCCTCCCAGCGATCCAGAGATGAACATGACA
GAAGAGTCCTTCACAGCTGTCATGACAACTGCAATTTCCAAGAACAAAACAAAGGAATAC
AAAATTGTTGGCATGTATTCAGATGGCATAAACGTCCTGGGCTTGATTGTCTTTTGCCTT
GTCTTTGGACTTGTCATTGGAAAAATGGGAGAAAAGGGACAAATTCTGGTGGATTTCTTC
AATGCTTTGAGTGATGCAACCATGAAAATCGTTCAGATCATCATGTGTTATATGCCACTA
GGTATTTTGTTCCTGATTGCTGGGAAGATCATAGAAGTTGAAGACTGGGAAATATTCCGC
AAGCTGGGCCTTTACATGGCCACAGTCCTGACTGGGCTTGCAATCCACTCCATTGTAATT
CTCCCGCTGATATATTTCATAGTCGTACGAAAGAACCCTTTCCGATTTGCCATGGGAATG
GCCCAGGCTCTCCTGACAGCTCTCATGATCTCTTCCAGTTCAGCAACACTGCCTGTCACC
TTCCGCTGTGCTGAAGAAAATAACCAGGTGGACAAGAGGATCACTCGATTCGTGTTACCC
GTTGGTGCAACAATCAACATGGATGGGACTGCGCTCTATGAAGCAGTGGCAGCGGTGTTT
ATTGCACAGTTGAATGACCTGGACTTGGGCATTGGGCAGATCATCACCATCAGTATCACG
GCCACATCTGCCAGCATCGGAGCTGCTGGCGTGCCCCAGGCTGGCCTGGTGACCATGGTG
ATTGTGCTGAGTGCCGTGGGCCTGCCCGCCGAGGATGTCACCCTGATCATTGCTGTCGAC
TGGCTCCTGGACCGGTTCAGGACCATGGTCAACGTCCTTGGTGATGCTTTTGGGACGGGC
ATTGTGGAAAAGCTCTCCAAGAAGGAGCTGGAGCAGATGGATGTTTCATCTGAAGTCAAC
ATTGTGAATCCCTTTGCCTTGGAATCCACAATCCTTGACAACGAAGACTCAGACACCAAG
AAGTCTTATGTCAATGGAGGCTTTGCAGTAGACAAGTCTGACACCATCTCATTCACCCAG
ACCTCACAGTTCTAG
Chromosome Location
9
Locus
9p24
External Identifiers
ResourceLink
UniProtKB IDP43005
UniProtKB Entry NameEAA3_HUMAN
GenBank Protein ID507898
GenBank Gene IDU08989
GenAtlas IDSLC1A1
HGNC IDHGNC:10939
General References
  1. Shashidharan P, Huntley GW, Meyer T, Morrison JH, Plaitakis A: Neuron-specific human glutamate transporter: molecular cloning, characterization and expression in human brain. Brain Res. 1994 Oct 31;662(1-2):245-50. [PubMed:7859077]
  2. Kanai Y, Stelzner M, Nussberger S, Khawaja S, Hebert SC, Smith CP, Hediger MA: The neuronal and epithelial human high affinity glutamate transporter. Insights into structure and mechanism of transport. J Biol Chem. 1994 Aug 12;269(32):20599-606. [PubMed:7914198]
  3. Arriza JL, Fairman WA, Wadiche JI, Murdoch GH, Kavanaugh MP, Amara SG: Functional comparisons of three glutamate transporter subtypes cloned from human motor cortex. J Neurosci. 1994 Sep;14(9):5559-69. [PubMed:7521911]
  4. Veenstra-VanderWeele J, Kim SJ, Gonen D, Hanna GL, Leventhal BL, Cook EH Jr: Genomic organization of the SLC1A1/EAAC1 gene and mutation screening in early-onset obsessive-compulsive disorder. Mol Psychiatry. 2001 Mar;6(2):160-7. [PubMed:11317217]
  5. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Melhem N, Middleton F, McFadden K, Klei L, Faraone SV, Vinogradov S, Tiobech J, Yano V, Kuartei S, Roeder K, Byerley W, Devlin B, Myles-Worsley M: Copy number variants for schizophrenia and related psychotic disorders in Oceanic Palau: risk and transmission in extended pedigrees. Biol Psychiatry. 2011 Dec 15;70(12):1115-21. doi: 10.1016/j.biopsych.2011.08.009. Epub 2011 Oct 7. [PubMed:21982423]
  8. Myles-Worsley M, Tiobech J, Browning SR, Korn J, Goodman S, Gentile K, Melhem N, Byerley W, Faraone SV, Middleton FA: Deletion at the SLC1A1 glutamate transporter gene co-segregates with schizophrenia and bipolar schizoaffective disorder in a 5-generation family. Am J Med Genet B Neuropsychiatr Genet. 2013 Mar;162B(2):87-95. doi: 10.1002/ajmg.b.32125. Epub 2013 Jan 22. [PubMed:23341099]
  9. Bailey CG, Ryan RM, Thoeng AD, Ng C, King K, Vanslambrouck JM, Auray-Blais C, Vandenberg RJ, Broer S, Rasko JE: Loss-of-function mutations in the glutamate transporter SLC1A1 cause human dicarboxylic aminoaciduria. J Clin Invest. 2011 Jan;121(1):446-53. doi: 10.1172/JCI44474. Epub 2010 Dec 1. [PubMed:21123949]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00128Aspartic acidapproved, nutraceuticalunknownDetails
DB00142Glutamic Acidapproved, nutraceuticalunknownDetails
DB00230Pregabalinapproved, illicit, investigationalunknownotherDetails