ATP-sensitive inward rectifier potassium channel 12

Details

Name
ATP-sensitive inward rectifier potassium channel 12
Synonyms
  • Inward rectifier K(+) channel Kir2.2
  • Inward rectifier K(+) channel Kir2.2v
  • IRK-2
  • IRK2
  • KCNJN1
  • Potassium channel, inwardly rectifying subfamily J member 12
Gene Name
KCNJ12
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010790|ATP-sensitive inward rectifier potassium channel 12
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM
DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGR
TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK
DLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGG
VLEQRPYRRESEI
Number of residues
433
Molecular Weight
49000.6
Theoretical pI
5.79
GO Classification
Functions
inward rectifier potassium channel activity
Processes
muscle contraction / potassium ion import / potassium ion transport / protein homotetramerization / regulation of heart contraction / regulation of ion transmembrane transport / synaptic transmission
Components
integral component of plasma membrane / intrinsic component of membrane / plasma membrane
General Function
Inward rectifier potassium channel activity
Specific Function
Inward rectifying potassium channel that is activated by phosphatidylinositol 4,5-bisphosphate and that probably participates in controlling the resting membrane potential in electrically excitable cells. Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.
Pfam Domain Function
Transmembrane Regions
83-107 157-181
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0010791|ATP-sensitive inward rectifier potassium channel 12 (KCNJ12)
ATGACCGCGGCCAGCCGGGCCAACCCCTACAGCATCGTGTCATCGGAGGAGGACGGGCTG
CACCTGGTCACCATGTCGGGCGCCAACGGCTTCGGCAACGGCAAGGTGCACACGCGGCGC
AGGTGCCGCAACCGCTTCGTCAAGAAGAATGGCCAGTGCAACATTGAGTTCGCCAACATG
GACGAGAAGTCACAGCGCTACCTGGCTGACATGTTCACCACCTGTGTGGACATCCGCTGG
CGGTACATGCTGCTCATCTTCTCGCTGGCCTTCCTTGCCTCCTGGCTGCTGTTCGGCATC
ATCTTCTGGGTCATCGCGGTGGCACACGGTGACCTGGAGCCGGCTGAGGGCCGGGGCCGC
ACACCCTGTGTGATGCAGGTGCACGGCTTCATGGCGGCCTTCCTCTTCTCCATCGAGACG
CAGACCACCATCGGCTACGGGCTGCGCTGTGTGACGGAGGAGTGCCCGGTGGCCGTCTTC
ATGGTGGTGGCCCAGTCCATCGTGGGCTGCATCATCGACTCCTTCATGATTGGTGCCATC
ATGGCCAAGATGGCAAGGCCCAAGAAGCGGGCACAGACGCTGCTGTTCAGCCACAACGCC
GTGGTGGCCCTGCGTGACGGCAAGCTCTGCCTCATGTGGCGTGTGGGTAACCTGCGCAAG
AGCCACATTGTGGAGGCCCATGTGCGCGCGCAGCTCATCAAGCCGCGGGTCACCGAGGAG
GGCGAGTACATCCCGCTGGACCAGATCGACATCGATGTGGGCTTCGACAAGGGCCTGGAC
CGCATCTTTCTGGTGTCGCCCATCACCATCTTGCATGAGATTGACGAGGCCAGCCCGCTC
TTCGGCATCAGCCGGCAGGACCTGGAGACGGACGACTTTGAGATCGTGGTCATCCTGGAA
GGCATGGTGGAGGCCACAGCCATGACCACCCAGGCCCGCAGCTCCTACCTGGCCAATGAG
ATCCTGTGGGGTCACCGCTTTGAGCCCGTGCTCTTCGAGGAGAAGAACCAGTACAAGATT
GACTACTCGCACTTCCACAAGACCTATGAGGTGCCCTCTACGCCCCGCTGCAGTGCGAAG
GATCTGGTAGAGAACAAGTTCCTGCTGCCCAGCGCCAACTCCTTCTGCTACGAGAACGAG
CTGGCCTTCCTGAGCCGTGACGAGGAGGATGAGGCGGACGGAGACCAGGACGGCCGAAGC
CGGGACGGCCTCAGCCCCCAGGCCAGGCATGACTTTGACAGACTCCAGGCTGGCGGCGGG
GTCCTGGAGCAGCGGCCCTACAGACGGGAGTCAGAGATCTGA
Chromosome Location
17
Locus
17p11.1
External Identifiers
ResourceLink
UniProtKB IDQ14500
UniProtKB Entry NameKCJ12_HUMAN
GenBank Protein ID567019
GenBank Gene IDL36069
GenAtlas IDKCNJ12
HGNC IDHGNC:6258
General References
  1. Wible BA, De Biasi M, Majumder K, Taglialatela M, Brown AM: Cloning and functional expression of an inwardly rectifying K+ channel from human atrium. Circ Res. 1995 Mar;76(3):343-50. [PubMed:7859381]
  2. Namba N, Inagaki N, Gonoi T, Seino Y, Seino S: Kir2.2v: a possible negative regulator of the inwardly rectifying K+ channel Kir2.2. FEBS Lett. 1996 May 20;386(2-3):211-4. [PubMed:8647284]
  3. Kaibara M, Ishihara K, Doi Y, Hayashi H, Ehara T, Taniyama K: Identification of human Kir2.2 (KCNJ12) gene encoding functional inward rectifier potassium channel in both mammalian cells and Xenopus oocytes. FEBS Lett. 2002 Nov 6;531(2):250-4. [PubMed:12417321]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Gallagher PG, Forget BG: An alternate promoter directs expression of a truncated, muscle-specific isoform of the human ankyrin 1 gene. J Biol Chem. 1998 Jan 16;273(3):1339-48. [PubMed:9430667]
  6. Preisig-Muller R, Schlichthorl G, Goerge T, Heinen S, Bruggemann A, Rajan S, Derst C, Veh RW, Daut J: Heteromerization of Kir2.x potassium channels contributes to the phenotype of Andersen's syndrome. Proc Natl Acad Sci U S A. 2002 May 28;99(11):7774-9. [PubMed:12032359]
  7. D'Avanzo N, Cheng WW, Doyle DA, Nichols CG: Direct and specific activation of human inward rectifier K+ channels by membrane phosphatidylinositol 4,5-bisphosphate. J Biol Chem. 2010 Nov 26;285(48):37129-32. doi: 10.1074/jbc.C110.186692. Epub 2010 Oct 4. [PubMed:20921230]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00204Dofetilideapproved, investigationalyesinhibitorDetails
DB01392Yohimbineapproved, investigational, vet_approvedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesantagonistDetails
DB00243Ranolazineapproved, investigationalunknowninhibitorDetails
DB04855DronedaroneapprovedyesinhibitorDetails