Inositol 1,4,5-trisphosphate receptor type 3

Details

Name
Inositol 1,4,5-trisphosphate receptor type 3
Synonyms
  • InsP3R3
  • IP3 receptor isoform 3
  • IP3R 3
  • Type 3 inositol 1,4,5-trisphosphate receptor
  • Type 3 InsP3 receptor
Gene Name
ITPR3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0019643|Inositol 1,4,5-trisphosphate receptor type 3
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGMGAQGRTGRRNAGEKIKYCLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQVFGILKAPFREKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIRTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFANTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
MLQAYEDPGGKNVRRSIQGVGHMMSTMVLSRKQSVFSAPSLSAGASAAEPLDRSKFEENE
DIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVE
AGAAKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDMARVCSKREKRVADPTLEKYVLSVVLDTINAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAILLPMDLDAHISSMLSSGASCAA
AAQRNASSYKATTRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSTSRGDLPDPIGTGLDPDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQS
SEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTG
GLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISP
LCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERE
NSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQML
KSSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTE
QDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIA
FFYPYMEGASTGVLDSPLISLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGP
TLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELF
YSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVD
RLPNNHSTASPLGMPHGAAAFVDTCSGDKMDCVSGLSVPEVLEEDRELDSTERACDTLLM
CIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNK
TDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLT
AQLNELKEQMTEQRKRRQRLGFVDVQNCISR
Number of residues
2671
Molecular Weight
304103.96
Theoretical pI
Not Available
GO Classification
Functions
calcium ion binding / calcium-release channel activity / inositol 1,3,4,5 tetrakisphosphate binding / inositol 1,4,5 trisphosphate binding / inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity / inositol hexakisphosphate binding / phosphatidylinositol binding
Processes
calcium ion transport into cytosol / G-protein coupled receptor signaling pathway / long-term synaptic potentiation / memory / platelet activation / positive regulation of cytosolic calcium ion concentration / protein heterooligomerization / protein homooligomerization / regulation of cardiac conduction / regulation of insulin secretion / response to calcium ion / sensory perception of bitter taste / sensory perception of sweet taste / sensory perception of umami taste
Components
apical part of cell / brush border / cytoplasm / endoplasmic reticulum / endoplasmic reticulum membrane / integral component of plasma membrane / membrane / myelin sheath / neuronal cell body / nuclear outer membrane / nucleolus / nucleoplasm / plasma membrane / platelet dense tubular network membrane / receptor complex
General Function
Receptor for inositol 1,4,5-trisphosphate, a second messenger that mediates the release of intracellular calcium.
Specific Function
Calcium ion binding
Pfam Domain Function
Transmembrane Regions
2203-2223 2236-2256 2265-2285 2326-2346 2369-2389 2497-2517
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0019644|Inositol 1,4,5-trisphosphate receptor type 3 (ITPR3)
ATGAGTGAAATGTCCAGCTTTCTTCACATCGGGGACATCGTCTCCCTGTACGCCGAGGGC
TCCGTCAATGGCTTCATCAGCACTTTGGGGCTGGTGGATGACCGCTGTGTGGTGGAGCCC
GCGGCCGGGGACCTGGACAACCCCCCTAAGAAGTTCCGTGACTGCCTCTTCAAGGTGTGC
CCCATGAACCGCTACTCGGCCCAGAAGCAGTACTGGAAGGCCAAGCAGACTAAGCAGGAC
AAGGAGAAGATCGCTGATGTGGTGTTGCTGCAGAAGCTGCAGCATGCGGCGCAGATGGAG
CAGAAGCAAAATGACACGGAGAACAAGAAGGTGCATGGGGATGTCGTGAAGTATGGCAGT
GTGATCCAGCTCCTGCACATGAAGAGCAACAAGTACCTGACAGTGAACAAGCGGCTTCCG
GCCTTGCTGGAGAAGAACGCCATGCGGGTGACTCTGGATGCCACAGGCAACGAGGGTTCC
TGGCTCTTCATCCAGCCCTTCTGGAAGCTGCGGAGCAACGGGGACAACGTGGTCGTGGGG
GACAAGGTGATCCTGAATCCTGTCAATGCCGGGCAGCCTCTGCATGCCAGCAATTACGAG
CTCAGCGACAACGCCGGCTGCAAGGAGGTCAATTCTGTGAACTGCAACACCAGCTGGAAG
ATCAACCTGTTTATGCAGTTTCGGGACCACCTGGAGGAGGTGTTGAAAGGGGGAGACGTG
GTGCGGCTGTTCCATGCGGAGCAGGAGAAGTTCCTGACGTGTGACGAGTACAAGGGCAAG
CTGCAGGTGTTCCTGCGAACTACACTGCGCCAGTCTGCCACCTCGGCCACCAGCTCCAAT
GCTCTCTGGGAGGTGGAGGTGGTCCACCACGACCCCTGCCGTGGAGGAGCTGGGCACTGG
AATGGCTTGTACCGCTTCAAGCACCTGGCTACAGGCAACTACCTGGCTGCTGAGGAGAAC
CCCAGTTACAAAGGTGATGCCTCAGATCCCAAGGCAGCAGGAATGGGGGCACAGGGCCGC
ACAGGCCGCAGGAATGCTGGGGAGAAGATCAAGTACTGCCTGGTGGCTGTGCCTCATGGC
AATGACATCGCCTCTCTCTTTGAGCTGGACCCCACCACCTTGCAGAAAACCGACTCTTTC
GTGCCCCGGAACTCGTACGTCCGGCTGCGGCACCTCTGCACCAACACGTGGATTCAGAGC
ACCAATGTGCCCATTGACATCGAGGAGGAGCGGCCCATCCGGCTCATGCTGGGCACCTGC
CCCACCAAGGAGGACAAGGAGGCCTTTGCCATCGTGTCAGTGCCCGTGTCTGAGATCCGA
GACCTGGACTTTGCCAATGACGCCAGCTCCATGCTGGCCAGTGCCGTGGAGAAACTCAAC
GAGGGCTTCATCAGCCAGAATGACCGCAGGTTTGTCATCCAGCTGCTGGAAGACCTGGTG
TTCTTTGTCAGCGATGTCCCCAACAATGGGCAGAATGTCCTGGACATCATGGTCACTAAG
CCCAACCGGGAACGGCAGAAGCTGATGAGGGAGCAGAACATCCTCAAACAGGTCTTTGGC
ATTCTGAAGGCCCCGTTCCGTGAGAAGGGGGGTGAAGGTCCCCTGGTGCGGCTGGAGGAG
CTGTCAGACCAGAAGAACGCCCCCTACCAGCACATGTTCCGCCTGTGCTACCGCGTGTTG
CGGCATTCCCAGGAGGACTACCGCAAGAACCAGGAGCACATTGCCAAGCAGTTTGGGATG
ATGCAGTCCCAGATTGGCTACGACATCCTGGCCGAGGACACCATCACTGCCCTGCTGCAC
AACAACCGCAAGCTCCTGGAAAAGCACATCACCAAGACCGAGGTGGAGACCTTCGTCAGC
CTTGTGCGCAAGAACCGGGAGCCCAGGTTCCTGGACTACCTCTCTGACCTGTGTGTGTCC
AACCACATCGCCATCCCCGTCACCCAAGAGCTCATCTGCAAGTGTGTGCTGGACCCCAAG
AACAGTGACATTCTCATCCGGACCGAGCTTCGGCCCGTGAAGGAGATGGCCCAATCCCAC
GAGTACCTGAGCATCGAGTACTCAGAAGAGGAAGTGTGGCTCACGTGGACTGACAAGAAT
AACGAGCATCATGAGAAGAGTGTGAGGCAGCTGGCCCAGGAGGCGCGGGCCGGCAACGCC
CACGACGAGAATGTGCTCAGCTACTACAGGTACCAGCTGAAGCTCTTTGCCCGCATGTGC
TTGGACCGCCAGTACTTGGCCATCGACGAGATCTCCCAGCAGCTGGGCGTGGACCTGATT
TTCCTGTGCATGGCAGACGAGATGCTGCCCTTTGACCTGCGCGCCTCCTTCTGCCACCTG
ATGCTGCACGTGCACGTGGACCGTGACCCCCAGGAGCTGGTCACGCCGGTCAAGTTTGCC
CGTCTCTGGACTGAGATCCCCACAGCCATCACCATCAAGGACTATGATTCCAACCTCAAC
GCGTCCCGAGATGACAAGAAGAACAAGTTTGCCAACACCATGGAGTTCGTGGAGGACTAC
CTCAACAATGTAGTCAGCGAGGCCGTGCCCTTTGCCAACGAGGAGAAGAACAAGCTCACT
TTTGAGGTGGTCAGCCTGGCGCACAATCTCATCTACTTCGGCTTCTACAGCTTCAGCGAG
CTGCTGCGGCTCACTCGCACACTGCTGGGCATCATCGACTGTGTGCAGGGGCCCCCGGCC
ATGCTGCAGGCCTATGAGGACCCCGGTGGCAAGAATGTGCGGCGGTCCATCCAGGGCGTG
GGGCACATGATGTCCACCATGGTGCTGAGCCGCAAGCAGTCCGTCTTCAGTGCCCCCAGC
CTGTCTGCTGGGGCCAGTGCTGCTGAGCCGCTGGACAGAAGCAAGTTTGAGGAGAATGAG
GACATTGTGGTGATGGAGACCAAGCTGAAGATCCTGGAAATCCTTCAGTTCATCCTCAAT
GTCCGCCTGGATTACCGCATATCCTACCTGCTGTCTGTCTTCAAGAAGGAGTTTGTGGAG
GTGTTTCCCATGCAGGACAGTGGGGCTGATGGCACAGCCCCTGCCTTCGACTCTACCACT
GCCAACATGAACCTGGATCGCATCGGGGAGCAGGCGGAGGCCATGTTTGGAGTGGGGAAG
ACAAGCAGCATGCTGGAGGTGGATGACGAGGGCGGCCGCATGTTCCTGCGCGTGCTCATC
CACCTCACCATGCACGACTATGCGCCGCTGGTCTCGGGTGCCCTGCAGCTGCTCTTCAAG
CACTTCAGCCAGCGCCAGGAGGCCATGCACACCTTCAAGCAGGTTCAGCTGCTGATCTCA
GCGCAGGACGTGGAGAACTACAAGGTGATCAAGTCGGAGCTGGACCGGCTGCGGACCATG
GTGGAGAAGTCAGAGCTGTGGGTGGACAAGAAGGGCAGTGGCAAGGGTGAGGAGGTGGAG
GCAGGCGCCGCCAAGGACAAGAAAGAGCGTCCCACGGACGAGGAGGGCTTTCTGCACCCA
CCAGGGGAGAAAAGCAGTGAGAACTACCAGATCGTCAAGGGCATCCTGGAAAGGCTGAAC
AAGATGTGCGGGGTTGGGGAGCAAATGAGGAAGAAGCAGCAACGGCTGCTGAAGAACATG
GATGCCCACAAGGTCATGCTGGACCTGCTGCAGATCCCCTATGACAAGGGTGATGCCAAG
ATGATGGAGATCCTGCGCTACACGCACCAGTTCCTGCAGAAGTTCTGTGCAGGGAACCCC
GGCAACCAGGCCCTGCTGCACAAACACCTGCACCTCTTCCTCACGCCAGGGCTCCTGGAG
GCAGAGACCATGCAGCACATCTTCCTGAACAACTATCAGCTCTGCTCCGAGATCAGCGAG
CCTGTGTTGCAGCACTTCGTGCACCTGCTGGCCACGCACGGGCGCCATGTGCAGTACCTG
GACTTCCTGCACACCGTCATTAAGGCCGAGGGCAAGTACGTCAAGAAGTGCCAGGACATG
ATCATGACTGAGCTGACCAATGCAGGTGACGATGTGGTCGTGTTCTACAATGATAAGGCA
TCGCTGGCCCACCTGCTGGACATGATGAAGGCCGCCCGCGACGGCGTGGAGGACCACAGC
CCCCTCATGTACCACATTTCCCTGGTGGACCTGCTGGCCGCCTGTGCCGAGGGCAAAAAC
GTCTACACTGAGATCAAGTGCACCTCCCTGCTGCCGCTGGAGGACGTGGTGTCTGTGGTG
ACGCATGAGGACTGCATCACTGAGGTGAAAATGGCCTATGTGAACTTCGTGAACCACTGC
TACGTGGACACGGAGGTGGAGATGAAGGAGATCTACACCAGCAACCACATCTGGACGCTC
TTTGAGAACTTCACCCTGGACATGGCTCGGGTCTGCAGCAAGCGTGAGAAGCGCGTGGCT
GACCCCACCTTGGAGAAGTACGTGCTGAGCGTTGTGCTGGACACCATCAACGCCTTCTTC
AGCTCCCCATTCTCTGAGAACAGCACTTCCCTGCAGACACACCAGACGATTGTGGTGCAG
CTGCTGCAGTCTACCACACGCCTCCTCGAGTGTCCGTGGCTACAGCAGCAGCACAAGGGC
TCCGTGGAGGCCTGCATCCGGACCCTCGCCATGGTGGCCAAGGGCCGGGCCATCTTGCTG
CCCATGGACCTGGATGCCCACATCAGCTCGATGCTCAGCAGTGGAGCCAGCTGTGCAGCT
GCCGCCCAGCGGAACGCCTCCAGCTACAAGGCAACCACGCGGGCCTTCCCCCGCGTCACC
CCCACCGCCAACCAGTGGGACTACAAGAACATCATTGAGAAGCTGCAGGACATCATCACA
GCCCTGGAGGAGCGGCTGAAGCCCCTGGTACAGGCTGAGCTGTCCGTGCTGGTGGATGTC
CTGCACTGGCCTGAGCTGCTCTTCCTGGAGGGCAGTGAGGCCTACCAGCGCTGCGAGAGT
GGGGGCTTCCTGTCCAAGCTGATCCAGCACACCAAGGACCTCATGGAGTCGGAGGAGAAG
CTGTGCATCAAGGTGCTGCGGACCCTGCAGCAGATGCTGCTCAAGAAGACCAAGTACGGG
GACCGGGGCAACCAGCTGCGCAAGATGCTGCTGCAAAACTACCTCCAGAACCGGAAGTCC
ACCTCGCGGGGGGACCTTCCCGACCCCATAGGCACTGGCCTGGACCCAGACTGGTCGGCA
ATCGCAGCCACCCAGTGCCGGCTGGACAAGGAGGGGGCCACCAAGTTGGTATGCGACCTC
ATCACCAGCACCAAGAACGAGAAGATCTTCCAGGAGAGCATCGGCCTGGCCATCCACCTG
CTGGATGGTGGCAACACAGAGATCCAGAAATCCTTCCACAACCTGATGATGAGTGACAAG
AAGTCAGAGCGCTTCTTCAAGGTGCTGCACGACCGCATGAAGCGGGCCCAGCAGGAGACC
AAGTCCACGGTGGCAGTCAACATGAATGACCTGGGCAGCCAGCCACATGAGGACCGCGAG
CCAGTCGACCCCACCACCAAAGGCCGCGTGGCCTCCTTCTCGATACCTGGCTCCTCATCC
CGCTACTCGCTGGGCCCCAGCCTGCGCCGGGGGCACGAGGTGAGCGAACGTGTGCAGAGC
AGTGAGATGGGCACATCCGTGCTCATCATGCAGCCCATCCTGCGCTTTCTGCAGCTGCTG
TGTGAGAACCACAACCGGGACCTGCAGAACTTCCTGCGCTGTCAGAACAACAAAACCAAC
TACAACTTGGTATGCGAGACGCTGCAGTTCCTGGACATCATGTGCGGCAGCACCACGGGC
GGCCTGGGGCTGCTGGGGCTCTACATCAATGAGGACAACGTGGGCCTCGTCATCCAGACC
TTGGAGACCCTCACTGAGTACTGCCAGGGCCCCTGCCATGAGAACCAGACTTGCATTGTG
ACTCACGAGTCCAATGGCATAGACATCATCACCGCACTGATCCTCAATGACATCAGCCCC
CTGTGCAAGTACCGCATGGATCTGGTGCTGCAGCTCAAGGACAATGCCTCCAAGCTGCTC
CTGGCTCTGATGGAGAGCCGGCATGACAGTGAAAATGCTGAGCGAATCCTCATCAGCCTG
CGGCCCCAGGAGCTGGTGGACGTCATCAAGAAGGCCTACCTGCAGGAGGAAGAGCGTGAG
AACTCGGAGGTGAGCCCACGTGAAGTGGGCCATAACATCTATATCCTGGCGCTGCAGCTC
TCCAGGCACAATAAACAGCTGCAGCACCTGCTGAAGCCGGTGAAGCGCATTCAAGAGGAG
GAGGCCGAGGGTATCTCTTCCATGCTCAGCCTCAACAACAAGCAGCTGTCACAGATGCTC
AAGTCCTCAGCGCCAGCACAGGAGGAGGAGGAAGACCCCCTGGCCTACTATGAGAACCAC
ACGTCCCAGATCGAGATTGTGCGGCAGGACCGCAGCATGGAGCAGATCGTGTTCCCAGTG
CCCGGCATCTGCCAGTTCCTGACGGAGGAAACCAAGCACCGGCTCTTCACCACTACTGAG
CAGGACGAGCAGGGCAGCAAAGTGAGCGACTTCTTCGACCAGTCCTCCTTCCTGCACAAC
GAGATGGAGTGGCAGCGCAAGCTCCGCAGCATGCCGCTGATCTACTGGTTCTCCCGCCGC
ATGACCCTGTGGGGCAGCATCTCCTTCAACCTGGCCGTGTTTATCAACATCATCATTGCC
TTCTTCTACCCTTACATGGAGGGCGCGTCCACAGGCGTGCTGGACTCCCCTCTCATCTCA
TTGCTCTTCTGGATCCTCATCTGCTTCTCCATCGCGGCCCTGTTCACCAAGCGCTACAGC
ATCCGCCCCCTCATCGTGGCGCTCATCCTGCGCTCCATCTACTATCTGGGCATCGGGCCC
ACACTCAACATCCTGGGTGCCCTCAATCTGACCAACAAGATCGTGTTTGTGGTGAGCTTC
GTGGGCAACCGTGGCACCTTCATCCGGGGCTATAAGGCCATGGTCATGGACATGGAATTC
CTCTACCACGTGGGCTACATCCTGACCAGTGTCCTGGGCCTCTTTGCTCATGAGCTGTTC
TACAGCATCCTGCTCTTTGACCTCATCTACCGCGAGGAGACGCTGTTCAACGTCATCAAG
AGTGTGACCCGCAATGGCCGCTCCATCCTGCTGACAGCCCTGCTGGCCCTCATCCTGGTC
TACCTCTTCTCCATCGTCGGCTTCCTCTTCCTCAAGGATGACTTCATTCTCGAGGTCGAC
CGGCTGCCCAACAACCACTCCACAGCCAGCCCCCTGGGGATGCCACATGGAGCTGCTGCA
TTTGTGGACACCTGCAGTGGGGACAAGATGGACTGTGTCTCAGGGCTCTCGGTGCCTGAG
GTCCTGGAAGAGGACAGGGAGCTGGACAGCACAGAGCGGGCCTGTGACACTCTGTTGATG
TGCATCGTCACTGTCATGAACCATGGGCTACGCAACGGTGGTGGCGTGGGCGACATTCTC
CGCAAGCCCTCCAAAGATGAGTCTCTCTTCCCAGCCCGAGTGGTCTATGACCTCCTGTTC
TTCTTCATCGTCATCATCATTGTGCTGAACCTCATCTTTGGGGTAATCATCGACACCTTC
GCTGACCTGCGTAGTGAGAAGCAGAAGAAGGAGGAGATTCTTAAGACGACATGCTTCATC
TGTGGTCTGGAGAGGGACAAGTTTGATAACAAGACAGTGTCATTTGAGGAACACATCAAG
CTGGAGCACAACATGTGGAACTACTTGTACTTCATTGTGCTGGTCCGCGTGAAGAACAAG
ACCGACTACACGGGCCCTGAGAGCTACGTGGCCCAGATGATCAAGAACAAGAACCTGGAC
TGGTTCCCCCGGATGCGGGCCATGTCCCTTGTCAGCAATGAGGGCGAGGGGGAGCAGAAT
GAGATTCGGATTCTCCAGGACAAGCTCAACTCCACCATGAAGCTGGTGTCCCACCTCACT
GCCCAGCTCAACGAGCTCAAGGAGCAGATGACGGAGCAGCGGAAACGCAGGCAACGCCTA
GGCTTTGTGGATGTCCAGAACTGCATTAGCCGCTGA
Chromosome Location
6
Locus
6p21.31
External Identifiers
ResourceLink
UniProtKB IDQ14573
UniProtKB Entry NameITPR3_HUMAN
HGNC IDHGNC:6182
General References
  1. Yamamoto-Hino M, Sugiyama T, Hikichi K, Mattei MG, Hasegawa K, Sekine S, Sakurada K, Miyawaki A, Furuichi T, Hasegawa M, et al.: Cloning and characterization of human type 2 and type 3 inositol 1,4,5-trisphosphate receptors. Receptors Channels. 1994;2(1):9-22. [PubMed:8081734]
  2. Maranto AR: Primary structure, ligand binding, and localization of the human type 3 inositol 1,4,5-trisphosphate receptor expressed in intestinal epithelium. J Biol Chem. 1994 Jan 14;269(2):1222-30. [PubMed:8288584]
  3. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404]
  4. Yang J, McBride S, Mak DO, Vardi N, Palczewski K, Haeseleer F, Foskett JK: Identification of a family of calcium sensors as protein ligands of inositol trisphosphate receptor Ca(2+) release channels. Proc Natl Acad Sci U S A. 2002 May 28;99(11):7711-6. [PubMed:12032348]
  5. Garcia-Elias A, Lorenzo IM, Vicente R, Valverde MA: IP3 receptor binds to and sensitizes TRPV4 channel to osmotic stimuli via a calmodulin-binding site. J Biol Chem. 2008 Nov 14;283(46):31284-8. doi: 10.1074/jbc.C800184200. Epub 2008 Sep 30. [PubMed:18826956]
  6. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  7. de Mattia F, Gubser C, van Dommelen MM, Visch HJ, Distelmaier F, Postigo A, Luyten T, Parys JB, de Smedt H, Smith GL, Willems PH, van Kuppeveld FJ: Human Golgi antiapoptotic protein modulates intracellular calcium fluxes. Mol Biol Cell. 2009 Aug;20(16):3638-45. doi: 10.1091/mbc.E09-05-0385. Epub 2009 Jun 24. [PubMed:19553469]
  8. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332]
  9. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  10. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  11. Tiwari A, Schneider M, Fiorino A, Haider R, Okoniewski MJ, Roschitzki B, Uzozie A, Menigatti M, Jiricny J, Marra G: Early insights into the function of KIAA1199, a markedly overexpressed protein in human colorectal tumors. PLoS One. 2013 Jul 23;8(7):e69473. doi: 10.1371/journal.pone.0069473. Print 2013. [PubMed:23936024]
  12. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  13. Shambharkar PB, Bittinger M, Latario B, Xiong Z, Bandyopadhyay S, Davis V, Lin V, Yang Y, Valdez R, Labow MA: TMEM203 Is a Novel Regulator of Intracellular Calcium Homeostasis and Is Required for Spermatogenesis. PLoS One. 2015 May 21;10(5):e0127480. doi: 10.1371/journal.pone.0127480. eCollection 2015. [PubMed:25996873]
  14. Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S: Toward a comprehensive characterization of a human cancer cell phosphoproteome. J Proteome Res. 2013 Jan 4;12(1):260-71. doi: 10.1021/pr300630k. Epub 2012 Dec 18. [PubMed:23186163]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00201CaffeineapprovedunknowninhibitorDetails