Electroneutral sodium bicarbonate exchanger 1

Details

Name
Electroneutral sodium bicarbonate exchanger 1
Synonyms
  • Electroneutral Na(+)-driven Cl-HCO3 exchanger
  • k-NBC3
  • KIAA0739
  • NBC
  • NBC3
  • NDCBE1
  • Solute carrier family 4 member 8
Gene Name
SLC4A8
Organism
Humans
Amino acid sequence
>lcl|BSEQ0009597|Electroneutral sodium bicarbonate exchanger 1
MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQS
HRHHRTHGQKHRRRGRGKGASQGEEGLEALAHDTPSQRVQFILGTEEDEEHVPHELFTEL
DEICMKEGEDAEWKETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCLINGTVLL
DMHANSIEEISDLILDQQELSSDLNDSMRVKVREALLKKHHHQNEKKRNNLIPIVRSFAE
VGKKQSDPHLMDKHGQTVSPQSVPTTNLEVKNGVNCEHSPVDLSKVDLHFMKKIPTGAEA
SNVLVGEVDILDRPIVAFVRLSPAVLLSGLTEVPIPTRFLFILLGPVGKGQQYHEIGRSM
ATIMTDEIFHDVAYKAKERDDLLAGIDEFLDQVTVLPPGEWDPSIRIEPPKNVPSQEKRK
MPGVPNGNVCHIEQEPHGGHSGPELQRTGRLFGGLVLDIKRKAPWYWSDYRDALSLQCLA
SFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQALTILGSTGP
VLVFEKILFKFCKDYALSYLSLRACIGLWTAFLCIVLVATDASSLVCYITRFTEEAFASL
ICIIFIYEAIEKLIHLAETYPIHMHSQLDHLSLYYCRCTLPENPNNHTLQYWKDHNIVTA
EVHWANLTVSECQEMHGEFMGSACGHHGPYTPDVLFWSCILFFTTFILSSTLKTFKTSRY
FPTRVRSMVSDFAVFLTIFTMVIIDFLIGVPSPKLQVPSVFKPTRDDRGWIINPIGPNPW
WTVIAAIIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAIMLGVCSIMGL
PWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFVLMGCSVFMTAILK
FIPMPVLYGVFLYMGVSSLQGIQFFDRLKLFGMPAKHQPDFIYLRHVPLRKVHLFTLIQL
TCLVLLWVIKASPAAIVFPMMVLALVFVRKVMDLCFSKRELSWLDDLMPESKKKKLDDAK
KKAKEEEEAEKMLEIGGDKFPLESRKLLSSPGKNISCRCDPSEINISDEMPKTTVWKALS
MNSGNAKEKSLFN
Number of residues
1093
Molecular Weight
122936.66
Theoretical pI
Not Available
GO Classification
Functions
inorganic anion exchanger activity / sodium
Processes
anion transmembrane transport / bicarbonate transport / ion transport / regulation of intracellular pH / sodium ion transmembrane transport / transmembrane transport
Components
integral component of plasma membrane / neuron projection / neuronal cell body membrane / plasma membrane
General Function
Sodium:bicarbonate symporter activity
Specific Function
Mediates electroneutral sodium- and carbonate-dependent chloride-HCO3(-) exchange with a Na(+):HCO3(-) stoichiometry of 2:1. Plays a major role in pH regulation in neurons. May be involved in cell pH regulation by transporting HCO3(-) from blood to cell. Enhanced expression in severe acid stress could be important for cell survival by mediating the influx of HCO3(-) into the cells. Also mediates lithium-dependent HCO3(-) cotransport. May be regulated by osmolarity.
Pfam Domain Function
Transmembrane Regions
479-499 524-544 566-586 596-616 688-708 732-752 779-799 825-845 882-902 905-925 963-983
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0019610|Electroneutral sodium bicarbonate exchanger 1 (SLC4A8)
ATGCCGGCCGCCGGGAGTAACGAGCCGGACGGCGTCCTCAGCTATCAGAGACCAGATGAA
GAAGCTGTGGTGGATCAGGGTGGGACCAGTACAATTCTCAACATTCACTATGAAAAAGAA
GAGCTGGAAGGTCACAGAACTCTGTATGTGGGAGTTCGGATGCCGCTTGGCCGGCAGAGC
CATCGGCATCACCGCACTCATGGCCAGAAGCACCGGAGACGAGGGCGGGGCAAAGGAGCC
AGCCAGGGGGAGGAAGGCCTGGAAGCCCTGGCCCACGACACACCATCTCAGCGTGTTCAG
TTCATTCTTGGCACCGAGGAAGATGAAGAGCATGTGCCTCATGAGCTGTTTACAGAGCTG
GATGAGATCTGTATGAAAGAGGGAGAAGATGCTGAGTGGAAGGAAACAGCCAGGTGGCTG
AAGTTTGAAGAAGATGTTGAAGATGGGGGAGAACGCTGGAGCAAGCCTTATGTGGCAACC
CTTTCATTGCACAGCCTGTTTGAGCTAAGGAGCTGCCTTATTAATGGAACAGTCCTCCTG
GATATGCATGCAAATAGCATAGAAGAAATTTCAGACCTGATCCTGGATCAGCAAGAACTG
TCCAGTGACCTGAATGACAGCATGAGGGTTAAAGTGCGGGAAGCCCTTCTCAAAAAGCAT
CATCATCAGAATGAAAAGAAGAGAAACAACCTCATTCCCATTGTTCGCTCCTTTGCTGAG
GTTGGCAAGAAGCAGTCTGATCCTCATTTGATGGATAAACATGGTCAAACCGTGTCTCCT
CAGTCTGTTCCAACTACAAATCTTGAAGTAAAAAATGGAGTGAATTGTGAACATAGTCCT
GTGGATTTAAGCAAGGTAGACCTTCATTTCATGAAAAAAATTCCTACTGGGGCCGAGGCC
TCCAATGTCCTGGTTGGAGAGGTGGATATTTTGGACCGTCCCATTGTTGCCTTTGTGAGG
CTGTCTCCAGCTGTTCTTCTCTCAGGCCTAACAGAAGTGCCAATCCCAACAAGATTTTTG
TTTATCTTATTGGGTCCAGTAGGGAAAGGTCAGCAGTACCATGAGATTGGCAGATCCATG
GCCACCATCATGACAGATGAGATTTTTCATGACGTAGCATATAAGGCAAAAGAGCGAGAT
GATCTCCTGGCGGGGATTGATGAGTTCCTAGACCAGGTGACGGTGCTCCCTCCAGGAGAG
TGGGATCCCTCCATTAGAATTGAGCCACCCAAAAATGTCCCTTCCCAGGAGAAAAGGAAA
ATGCCTGGAGTTCCAAATGGAAATGTTTGCCACATAGAACAGGAACCACATGGGGGTCAC
AGTGGGCCAGAACTTCAGCGCACTGGGCGGCTATTTGGGGGCTTGGTGCTGGACATCAAG
CGGAAGGCCCCCTGGTACTGGAGCGACTACCGAGATGCACTCAGCTTACAGTGTTTGGCT
TCCTTTCTGTTCCTGTACTGTGCCTGCATGTCACCTGTCATCACCTTTGGGGGACTGCTT
GGAGAAGCCACTGAGGGACGCATAAGTGCAATTGAATCCTTGTTTGGAGCTTCCATGACT
GGGATTGCTTATTCCTTGTTTGCGGGACAGGCTCTCACCATCCTGGGAAGTACTGGACCA
GTGCTTGTGTTTGAAAAGATTTTGTTCAAATTCTGCAAAGACTATGCTCTTTCATACCTC
TCCCTGCGAGCTTGTATTGGACTGTGGACCGCTTTCCTGTGTATTGTCCTTGTGGCAACT
GATGCCAGTTCCCTTGTCTGCTACATTACCCGTTTCACTGAAGAAGCATTTGCCTCCCTA
ATTTGCATTATTTTCATCTATGAAGCAATAGAAAAACTGATTCACCTGGCAGAGACCTAC
CCCATCCACATGCACAGCCAGCTGGACCACCTTAGCCTCTATTACTGCAGGTGTACTCTG
CCAGAGAATCCAAACAATCACACCCTCCAGTACTGGAAGGACCACAACATCGTGACAGCA
GAAGTCCACTGGGCTAACCTGACTGTCAGTGAATGCCAGGAGATGCATGGAGAGTTCATG
GGATCTGCGTGCGGCCATCATGGACCCTACACTCCTGATGTCCTCTTTTGGTCCTGTATT
CTCTTTTTCACCACCTTCATCCTCTCAAGCACCTTAAAGACGTTTAAGACGAGCCGTTAT
TTCCCAACCAGAGTACGCTCCATGGTGAGTGACTTTGCTGTTTTCCTCACTATCTTCACA
ATGGTGATTATTGATTTTTTGATTGGAGTCCCATCACCAAAGCTTCAAGTTCCCAGTGTG
TTCAAGCCAACAAGGGATGATCGCGGATGGATTATTAATCCCATTGGCCCCAATCCCTGG
TGGACTGTGATAGCTGCAATTATCCCAGCTCTTCTCTGTACTATCTTGATATTCATGGAT
CAGCAGATCACAGCCGTCATTATTAACAGGAAGGAACATAAGCTCAAGAAAGGCTGTGGC
TACCACCTGGACCTACTGATGGTGGCCATCATGCTGGGTGTCTGCTCCATCATGGGCCTG
CCCTGGTTTGTAGCTGCAACTGTCTTGTCCATCACACATGTGAACAGCCTCAAGCTAGAA
TCTGAATGCTCTGCTCCTGGAGAACAGCCCAAGTTCCTGGGCATCCGAGAACAGAGAGTG
ACAGGCCTTATGATCTTTGTGCTGATGGGCTGCTCAGTCTTCATGACGGCTATCTTAAAG
TTTATTCCAATGCCAGTACTCTACGGAGTTTTCCTTTACATGGGAGTTTCTTCACTACAG
GGAATTCAGTTCTTTGATCGTCTAAAGCTCTTTGGGATGCCCGCAAAGCACCAGCCAGAT
TTCATCTACCTGCGGCATGTGCCGCTGCGCAAAGTGCACCTCTTCACCCTCATCCAGTTG
ACCTGTCTCGTCCTGCTCTGGGTCATCAAGGCATCTCCAGCTGCCATTGTTTTCCCAATG
ATGGTTTTGGCCTTGGTCTTTGTCAGGAAAGTCATGGATCTCTGTTTCTCTAAGCGAGAG
CTGAGCTGGCTAGATGATCTCATGCCTGAAAGCAAAAAGAAGAAGTTGGATGATGCCAAA
AAGAAGGCCAAGGAGGAAGAGGAGGCTGAGAAAATGTTAGAAATTGGGGGAGACAAGTTT
CCCTTAGAGAGCAGGAAGTTACTAAGTAGTCCTGGAAAGAACATCAGTTGCAGATGTGAC
CCCTCTGAGATTAATATATCTGATGAAATGCCTAAAACTACAGTTTGGAAAGCTCTCAGT
ATGAATTCTGGAAATGCAAAGGAAAAGAGTCTCTTCAACTAA
Chromosome Location
12
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ2Y0W8
UniProtKB Entry NameS4A8_HUMAN
HGNC IDHGNC:11034
General References
  1. Grichtchenko II, Choi I, Zhong X, Bray-Ward P, Russell JM, Boron WF: Cloning, characterization, and chromosomal mapping of a human electroneutral Na(+)-driven Cl-HCO3 exchanger. J Biol Chem. 2001 Mar 16;276(11):8358-63. Epub 2000 Dec 27. [PubMed:11133997]
  2. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. [PubMed:9872452]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005]
  5. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Amlal H, Burnham CE, Soleimani M: Characterization of Na+/HCO-3 cotransporter isoform NBC-3. Am J Physiol. 1999 Jun;276(6 Pt 2):F903-13. [PubMed:10362779]
  8. Damkier HH, Nielsen S, Praetorius J: Molecular expression of SLC4-derived Na+-dependent anion transporters in selected human tissues. Am J Physiol Regul Integr Comp Physiol. 2007 Nov;293(5):R2136-46. Epub 2007 Aug 22. [PubMed:17715183]
  9. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01390Sodium bicarbonateapprovedunknownsubstrateDetails