Aclacinomycin 10-hydroxylase RdmB

Details

Name
Aclacinomycin 10-hydroxylase RdmB
Synonyms
  • 15-demethoxy-epsilon-rhodomycin 10-hydroxylase
  • 15-demethoxyaclacinomycin T
  • 4.1.1.-
Gene Name
rdmB
Organism
Streptomyces purpurascens
Amino acid sequence
>lcl|BSEQ0022287|Aclacinomycin 10-hydroxylase RdmB
MSSSSPGEPLEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTD
THPQALSRLVRHLTVVGVLEGGEKQGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHAD
LAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDW
SAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGD
FFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADVEGDGADRFF
STLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVSEEA
APAAQASEALPAQE
Number of residues
374
Molecular Weight
39796.525
Theoretical pI
4.48
GO Classification
Functions
carboxy-lyase activity / O-methyltransferase activity
Processes
antibiotic biosynthetic process
General Function
Not Available
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0004960|1125 bp
GTGAGCTCTTCCTCACCCGGGGAACCCCTGGAACCGACCGACCAGGACCTCGACGTACTC
CTGAAGAACCTCGGCAATCTGGTGACCCCGATGGCCCTGAGGGTCGCCGCGACACTCCGC
CTGGTCGATCACCTGCTGGCCGGAGCCGACACCCTCGCCGGCCTCGCCGACCGTACGGAC
ACCCATCCCCAGGCGCTCTCCCGCCTGGTCCGGCACCTGACCGTCGTCGGCGTCCTGGAG
GGCGGCGAGAAGCAGGGCCGGCCGCTGCGCCCCACCCGGCTCGGGATGCTCCTCGCCGAC
GGCCACCCGGCCCAGCAGCGGGCCTGGCTGGACCTGAACGGGGCCGTCTCCCACGCCGAC
CTGGCCTTCACCGGGCTCCTCGACGTGGTCCGCACCGGCCGCCCCGCCTACGCCGGGCGG
TACGGGCGGCCCTTCTGGGAGGACCTCTCGGCGGACGTGGCGCTGGCCGACTCCTTCGAC
GCGCTCATGTCCTGCGACGAGGACCTGGCCTACGAGGCCCCGGCCGACGCGTACGACTGG
TCGGCGGTCCGGCACGTCCTCGACGTGGGCGGCGGCAACGGCGGCATGCTCGCGGCGATC
GCCCTGCGGGCCCCGCACCTGCGCGGCACCCTGGTCGAACTGGCCGGTCCCGCCGAGCGC
GCCCGGCGCAGGTTCGCGGACGCCGGTCTGGCCGACCGGGTCACGGTGGCGGAGGGCGAC
TTCTTCAAGCCGCTGCCCGTCACCGCCGACGTCGTCCTGCTGTCGTTCGTCCTGCTCAAC
TGGTCCGACGAGGACGCGCTGACGATCCTGCGCGGCTGCGTCAGGGCGCTGGAGCCGGGA
GGCAGGCTCCTGGTCCTCGACCGTGCCGATGTCGAGGGGGACGGCGCCGACCGGTTCTTC
AGCACGCTGCTCGACCTGCGGATGCTGACGTTCATGGGCGGACGGGTGCGCACCCGGGAC
GAGGTCGTGGACCTGGCCGGATCGGCCGGACTCGCCCTGGCCTCGGAGCGCACGAGCGGC
TCCACGACCCTCCCGTTCGACTTCTCGATCCTCGAGTTCACGGCCGTCTCCGAGGAAGCG
GCCCCGGCCGCCCAGGCCTCCGAAGCCCTCCCAGCACAGGAGTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ54527
UniProtKB Entry NameRDMB_STREF
GenBank Gene IDU10405
General References
  1. Niemi J, Ylihonko K, Hakala J, Parssinen R, Kopio A, Mantsala P: Hybrid anthracycline antibiotics: production of new anthracyclines by cloned genes from Streptomyces purpurascens in Streptomyces galilaeus. Microbiology. 1994 Jun;140 ( Pt 6):1351-8. [PubMed:8081500]
  2. Niemi J, Mantsala P: Nucleotide sequences and expression of genes from Streptomyces purpurascens that cause the production of new anthracyclines in Streptomyces galilaeus. J Bacteriol. 1995 May;177(10):2942-5. [PubMed:7751313]
  3. Wang Y, Niemi J, Airas K, Ylihonko K, Hakala J, Mantsala P: Modifications of aclacinomycin T by aclacinomycin methyl esterase (RdmC) and aclacinomycin-10-hydroxylase (RdmB) from Streptomyces purpurascens. Biochim Biophys Acta. 2000 Jul 14;1480(1-2):191-200. [PubMed:11004563]
  4. Jansson A, Niemi J, Lindqvist Y, Mantsala P, Schneider G: Crystal structure of aclacinomycin-10-hydroxylase, a S-adenosyl-L-methionine-dependent methyltransferase homolog involved in anthracycline biosynthesis in Streptomyces purpurascens. J Mol Biol. 2003 Nov 21;334(2):269-80. [PubMed:14607118]
  5. Jansson A, Koskiniemi H, Erola A, Wang J, Mantsala P, Schneider G, Niemi J: Aclacinomycin 10-hydroxylase is a novel substrate-assisted hydroxylase requiring S-adenosyl-L-methionine as cofactor. J Biol Chem. 2005 Feb 4;280(5):3636-44. Epub 2004 Nov 17. [PubMed:15548527]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01752S-adenosyl-L-homocysteineexperimentalunknownDetails
DB01910SinefunginexperimentalunknownDetails
DB0321911-Deoxy-Beta-RhodomycinexperimentalunknownDetails