30S ribosomal protein S18
Details
- Name
- 30S ribosomal protein S18
- Synonyms
- Not Available
- Gene Name
- rpsR
- Organism
- Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
- Amino acid sequence
>lcl|BSEQ0012927|30S ribosomal protein S18 MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSA KEQRILAKTIKRARILGLLPFTEKLVRK
- Number of residues
- 88
- Molecular Weight
- 10231.105
- Theoretical pI
- 12.1
- GO Classification
- FunctionsrRNA binding / structural constituent of ribosomeProcessestranslationComponentsribosome
- General Function
- Structural constituent of ribosome
- Specific Function
- Located on the back of the platform of the 30S subunit where it stabilizes the close packing of several RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome, where it probably interacts with the Shine-Dalgarno helix.
- Pfam Domain Function
- Ribosomal_S18 (PF01084)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0012928|30S ribosomal protein S18 (rpsR) TTGAGCACGAAGAACGCGAAACCCAAGAAGGAGGCGCAGAGGCGCCCGTCCCGCAAGGCT AAGGTCAAGGCCACCCTGGGGGAGTTTGACCTCAGGGACTACCGGAACGTGGAGGTGCTC AAGCGGTTCCTGTCGGAGACGGGGAAGATCCTTCCCCGCCGCCGCACGGGGCTTTCCGCC AAGGAGCAGAGGATCCTGGCCAAGACCATCAAGCGGGCGAGGATCCTAGGGCTCCTGCCC TTCACGGAGAAGCTGGTGCGGAAGTAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q5SLQ0 UniProtKB Entry Name RS18_THET8 GenBank Protein ID 55771383 GenBank Gene ID AP008226 - General References
- Tsiboli P, Herfurth E, Choli T: Purification and characterization of the 30S ribosomal proteins from the bacterium Thermus thermophilus. Eur J Biochem. 1994 Nov 15;226(1):169-77. [Article]
- Suh MJ, Hamburg DM, Gregory ST, Dahlberg AE, Limbach PA: Extending ribosomal protein identifications to unsequenced bacterial strains using matrix-assisted laser desorption/ionization mass spectrometry. Proteomics. 2005 Dec;5(18):4818-31. [Article]
- Wimberly BT, Brodersen DE, Clemons WM Jr, Morgan-Warren RJ, Carter AP, Vonrhein C, Hartsch T, Ramakrishnan V: Structure of the 30S ribosomal subunit. Nature. 2000 Sep 21;407(6802):327-39. [Article]
- Schluenzen F, Tocilj A, Zarivach R, Harms J, Gluehmann M, Janell D, Bashan A, Bartels H, Agmon I, Franceschi F, Yonath A: Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution. Cell. 2000 Sep 1;102(5):615-23. [Article]
- Brodersen DE, Clemons WM Jr, Carter AP, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit. Cell. 2000 Dec 22;103(7):1143-54. [Article]
- Carter AP, Clemons WM, Brodersen DE, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics. Nature. 2000 Sep 21;407(6802):340-8. [Article]
- Agalarov SC, Sridhar Prasad G, Funke PM, Stout CD, Williamson JR: Structure of the S15,S6,S18-rRNA complex: assembly of the 30S ribosome central domain. Science. 2000 Apr 7;288(5463):107-13. [Article]
- Yusupova GZ, Yusupov MM, Cate JH, Noller HF: The path of messenger RNA through the ribosome. Cell. 2001 Jul 27;106(2):233-41. [Article]
- Pioletti M, Schlunzen F, Harms J, Zarivach R, Gluhmann M, Avila H, Bashan A, Bartels H, Auerbach T, Jacobi C, Hartsch T, Yonath A, Franceschi F: Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3. EMBO J. 2001 Apr 17;20(8):1829-39. [Article]
- Carter AP, Clemons WM Jr, Brodersen DE, Morgan-Warren RJ, Hartsch T, Wimberly BT, Ramakrishnan V: Crystal structure of an initiation factor bound to the 30S ribosomal subunit. Science. 2001 Jan 19;291(5503):498-501. [Article]
- Yusupov MM, Yusupova GZ, Baucom A, Lieberman K, Earnest TN, Cate JH, Noller HF: Crystal structure of the ribosome at 5.5 A resolution. Science. 2001 May 4;292(5518):883-96. Epub 2001 Mar 29. [Article]
- Ogle JM, Brodersen DE, Clemons WM Jr, Tarry MJ, Carter AP, Ramakrishnan V: Recognition of cognate transfer RNA by the 30S ribosomal subunit. Science. 2001 May 4;292(5518):897-902. [Article]
- Brodersen DE, Clemons WM Jr, Carter AP, Wimberly BT, Ramakrishnan V: Crystal structure of the 30 S ribosomal subunit from Thermus thermophilus: structure of the proteins and their interactions with 16 S RNA. J Mol Biol. 2002 Feb 22;316(3):725-68. [Article]
- Sharma MR, Barat C, Wilson DN, Booth TM, Kawazoe M, Hori-Takemoto C, Shirouzu M, Yokoyama S, Fucini P, Agrawal RK: Interaction of Era with the 30S ribosomal subunit implications for 30S subunit assembly. Mol Cell. 2005 Apr 29;18(3):319-29. [Article]