Solute carrier family 2, facilitated glucose transporter member 12

Details

Name
Solute carrier family 2, facilitated glucose transporter member 12
Synonyms
  • Glucose transporter type 12
  • GLUT-12
  • GLUT12
  • GLUT8
Gene Name
SLC2A12
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008986|Solute carrier family 2, facilitated glucose transporter member 12
MVPVENTEGPSLLNQKGTAVETEGSGSRHPPWARGCGMFTFLSSVTAAVSGLLVGYELGI
ISGALLQIKTLLALSCHEQEMVVSSLVIGALLASLTGGVLIDRYGRRTAIILSSCLLGLG
SLVLILSLSYTVLIVGRIAIGVSISLSSIATCVYIAEIAPQHRRGLLVSLNELMIVIGIL
SAYISNYAFANVFHGWKYMFGLVIPLGVLQAIAMYFLPPSPRFLVMKGQEGAASKVLGRL
RALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTRIMIGLTLVFFVQITGQPNILFY
ASTVLKSVGFQSNEAASLASTGVGVVKVISTIPATLLVDHVGSKTFLCIGSSVMAASLVT
MGIVNLNIHMNFTHICRSHNSINQSLDESVIYGPGNLSTNNNTLRDHFKGISSHSRSSLM
PLRNDVDKRGETTSASLLNAGLSHTEYQIVTDPGDVPAFLKWLSLASLLVYVAAFSIGLG
PMPWLVLSEIFPGGIRGRAMALTSSMNWGINLLISLTFLTVTDLIGLPWVCFIYTIMSLA
SLLFVVMFIPETKGCSLEQISMELAKVNYVKNNICFMSHHQEELVPKQPQKRKPQEQLLE
CNKLCGRGQSRQLSPET
Number of residues
617
Molecular Weight
66965.7
Theoretical pI
Not Available
GO Classification
Functions
substrate-specific transmembrane transporter activity
Processes
glucose transport / transmembrane transport
Components
endomembrane system / integral component of membrane / perinuclear region of cytoplasm / plasma membrane
General Function
Substrate-specific transmembrane transporter activity
Specific Function
Facilitative glucose transporter.
Pfam Domain Function
Transmembrane Regions
45-65 81-101 116-136 138-158 173-193 198-218 279-299 318-338 346-366 467-487 499-519 529-549
Cellular Location
Endomembrane system
Gene sequence
>lcl|BSEQ0020846|Solute carrier family 2, facilitated glucose transporter member 12 (SLC2A12)
ATGGTACCTGTTGAAAACACCGAGGGCCCCAGTCTGCTGAACCAGAAGGGGACAGCCGTG
GAGACGGAGGGCAGCGGCAGCCGGCATCCTCCCTGGGCGAGAGGCTGCGGCATGTTTACC
TTCCTGTCATCTGTCACTGCTGCTGTCAGTGGCCTCCTGGTGGGTTATGAACTTGGGATC
ATCTCTGGGGCTCTTCTTCAGATCAAAACCTTATTAGCCCTGAGCTGCCATGAGCAGGAA
ATGGTTGTGAGCTCCCTCGTCATTGGAGCCCTCCTTGCCTCACTCACCGGAGGGGTCCTG
ATAGACAGATATGGAAGAAGGACAGCAATCATCTTGTCATCCTGCCTGCTTGGACTCGGA
AGCTTAGTCTTGATCCTCAGTTTATCCTACACGGTTCTTATAGTGGGACGCATTGCCATA
GGGGTCTCCATCTCCCTCTCTTCCATTGCCACTTGTGTTTACATCGCAGAGATTGCTCCT
CAACACAGAAGAGGCCTTCTTGTGTCACTGAATGAGCTGATGATTGTCATCGGCATTCTT
TCTGCCTATATTTCAAATTACGCATTTGCCAATGTTTTCCATGGCTGGAAGTACATGTTT
GGTCTTGTGATTCCCTTGGGAGTTTTGCAAGCAATTGCAATGTATTTTCTTCCTCCAAGC
CCTCGGTTTCTGGTGATGAAAGGACAAGAGGGAGCTGCTAGCAAGGTTCTTGGAAGGTTA
AGAGCACTCTCAGATACAACTGAGGAACTCACTGTGATCAAATCCTCCCTGAAAGATGAA
TATCAGTACAGTTTTTGGGATCTGTTTCGTTCAAAAGACAACATGCGGACCCGAATAATG
ATAGGACTAACACTAGTATTTTTTGTACAAATCACTGGCCAACCAAACATATTGTTCTAT
GCATCAACTGTTTTGAAGTCAGTTGGATTTCAAAGCAATGAGGCAGCTAGCCTCGCCTCC
ACTGGGGTTGGAGTCGTCAAGGTCATTAGCACCATCCCTGCCACTCTTCTTGTAGACCAT
GTCGGCAGCAAAACATTCCTCTGCATTGGCTCCTCTGTGATGGCAGCTTCGTTGGTGACC
ATGGGCATCGTAAATCTCAACATCCACATGAACTTCACCCATATCTGCAGAAGCCACAAT
TCTATCAACCAGTCCTTGGATGAGTCTGTGATTTATGGACCAGGAAACCTGTCAACCAAC
AACAATACTCTCAGAGACCACTTCAAAGGGATTTCTTCCCATAGCAGAAGCTCACTCATG
CCCCTGAGAAATGATGTGGATAAGAGAGGGGAGACGACCTCAGCATCCTTGCTAAATGCT
GGATTAAGCCACACTGAATACCAGATAGTCACAGACCCTGGGGACGTCCCAGCTTTTTTG
AAATGGCTGTCCTTAGCCAGCTTGCTTGTTTATGTTGCTGCTTTTTCAATTGGTCTAGGA
CCAATGCCCTGGCTGGTGCTCAGCGAGATCTTTCCTGGTGGGATCAGAGGACGAGCCATG
GCTTTAACTTCTAGCATGAACTGGGGCATCAATCTCCTCATCTCGCTGACATTTTTGACT
GTAACTGATCTTATTGGCCTGCCATGGGTGTGCTTTATATATACAATCATGAGTCTAGCA
TCCCTGCTTTTTGTTGTTATGTTTATACCTGAGACAAAGGGATGCTCTTTGGAACAAATA
TCAATGGAGCTAGCAAAAGTGAACTATGTGAAAAACAACATTTGTTTTATGAGTCATCAC
CAAGAAGAATTAGTGCCAAAACAGCCTCAAAAAAGAAAACCCCAGGAGCAGCTCTTGGAG
TGTAACAAGCTGTGTGGTAGGGGCCAATCCAGGCAGCTTTCTCCAGAGACCTAA
Chromosome Location
6
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ8TD20
UniProtKB Entry NameGTR12_HUMAN
HGNC IDHGNC:18067
General References
  1. Rogers S, Macheda ML, Docherty SE, Carty MD, Henderson MA, Soeller WC, Gibbs EM, James DE, Best JD: Identification of a novel glucose transporter-like protein-GLUT-12. Am J Physiol Endocrinol Metab. 2002 Mar;282(3):E733-8. [PubMed:11832379]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09502Fludeoxyglucose (18F)approved, investigationalyessubstrateDetails
DB09341Dextrose, unspecified formapproved, vet_approvedunknownsubstrateDetails
DB01914D-glucoseapproved, investigational, vet_approvednosubstrateDetails