Small conductance calcium-activated potassium channel protein 1

Details

Name
Small conductance calcium-activated potassium channel protein 1
Synonyms
  • KCa2.1
  • SK
  • SK1
Gene Name
KCNN1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008404|Small conductance calcium-activated potassium channel protein 1
MNSHSYNGSVGRPLGSGPGALGRDPPDPEAGHPPQPPHSPGLQVVVAKSEPARPSPGSPR
GQPQDQDDDEDDEEDEAGRQRASGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVV
MVTETELSWGVYTKESLYSFALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIA
MTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAEADVDVLLSIPMFLRLYL
LGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWT
VRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTAL
VVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARV
RKHQRKFLQAIHQAQKLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEA
RLATLESRLDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQAARSSPCRWTPVAPS
DCG
Number of residues
543
Molecular Weight
59986.87
Theoretical pI
9.05
GO Classification
Functions
calcium-activated potassium channel activity / calmodulin binding / small conductance calcium-activated potassium channel activity
Processes
potassium ion transmembrane transport / potassium ion transport / synaptic transmission
Components
neuronal cell body / plasma membrane / voltage-gated potassium channel complex
General Function
Small conductance calcium-activated potassium channel activity
Specific Function
Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin (By similarity).
Pfam Domain Function
Transmembrane Regions
111-131 140-160 179-199 228-248 277-297 346-366
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0013102|Small conductance calcium-activated potassium channel protein 1 (KCNN1)
ATGAACAGCCACAGCTACAATGGCAGCGTGGGGCGGCCGCTGGGCAGCGGGCCGGGCGCC
CTGGGACGAGACCCTCCGGACCCTGAGGCCGGCCACCCCCCACAACCCCCGCACAGCCCG
GGCCTCCAGGTGGTAGTGGCCAAGAGTGAGCCAGCCCGGCCCTCACCCGGCAGCCCCCGG
GGGCAGCCCCAGGACCAGGACGATGACGAGGATGATGAGGAAGATGAGGCCGGCAGGCAG
AGAGCCTCGGGGAAACCCTCAAATGTGGGCCACCGCCTGGGCCACCGGCGGGCGCTCTTC
GAGAAGCGGAAGCGCCTCAGCGACTATGCCCTCATTTTCGGCATGTTTGGCATCGTCGTC
ATGGTGACGGAGACCGAGCTGTCCTGGGGGGTGTACACCAAGGAGTCTCTGTACTCATTC
GCACTCAAATGCCTCATCAGCCTCTCCACGGCCATCCTGCTGGGTCTCGTTGTCCTCTAC
CATGCCCGGGAGATCCAGCTGTTCATGGTGGACAACGGGGCTGATGACTGGCGCATCGCC
ATGACCTGCGAGCGCGTGTTCCTCATCTCGCTAGAGCTGGCAGTGTGCGCCATTCACCCG
GTGCCCGGCCACTACCGCTTCACGTGGACGGCGCGGCTGGCCTTCACGTACGCGCCCTCG
GTGGCCGAGGCCGACGTGGACGTGCTGCTGTCCATCCCCATGTTCCTGCGCCTCTACCTG
CTGGGCCGGGTGATGCTACTGCACAGCAAAATCTTCACGGACGCCTCGAGCCGCAGCATC
GGGGCCCTCAACAAGATCACCTTCAACACGCGCTTCGTCATGAAGACACTCATGACCATC
TGCCCCGGCACCGTGCTGCTGGTCTTCAGCATCTCCTCCTGGATCATCGCAGCCTGGACC
GTGCGCGTCTGCGAGAGGTACCACGACAAGCAGGAAGTGACCAGCAACTTCCTGGGGGCC
ATGTGGCTGATTTCCATCACCTTCCTCTCCATTGGCTACGGCGACATGGTGCCCCACACC
TACTGCGGGAAGGGTGTGTGCCTGCTCACTGGCATCATGGGAGCTGGCTGTACCGCGCTC
GTGGTGGCTGTGGTGGCTCGGAAGCTGGAGCTCACCAAGGCTGAGAAGCACGTGCACAAC
TTCATGATGGACACTCAGCTCACCAAGCGGGTAAAAAACGCCGCTGCTAACGTTCTCAGG
GAGACGTGGCTCATCTACAAACATACCAGGCTGGTGAAGAAGCCAGACCAAGCCCGGGTT
CGGAAACACCAGCGTAAGTTCCTCCAAGCCATCCATCAGGCTCAGAAGCTCCGGAGTGTG
AAGATCGAGCAAGGGAAGCTGAACGACCAGGCTAACACGCTTACCGACCTAGCCAAGACC
CAGACCGTCATGTACGACCTTGTATCGGAGCTGCACGCTCAGCACGAGGAGCTGGAGGCC
CGCCTGGCCACCCTGGAAAGCCGCTTGGATGCGCTGGGTGCCTCTCTACAGGCCCTGCCT
GGCCTCATCGCCCAAGCCATACGCCCACCCCCGCCTCCCCTGCCTCCCAGGCCCGGCCCC
GGCCCCCAAGACCAGGCAGCCCGGAGCTCCCCCTGCCGGTGGACGCCCGTGGCCCCCTCG
GACTGCGGGTGA
Chromosome Location
19
Locus
19p13.1
External Identifiers
ResourceLink
UniProtKB IDQ92952
UniProtKB Entry NameKCNN1_HUMAN
GenBank Protein ID1575661
GenBank Gene IDU69883
HGNC IDHGNC:6290
General References
  1. Kohler M, Hirschberg B, Bond CT, Kinzie JM, Marrion NV, Maylie J, Adelman JP: Small-conductance, calcium-activated potassium channels from mammalian brain. Science. 1996 Sep 20;273(5282):1709-14. [PubMed:8781233]
  2. Litt M, LaMorticella D, Bond CT, Adelman JP: Gene structure and chromosome mapping of the human small-conductance calcium-activated potassium channel SK1 gene (KCNN1). Cytogenet Cell Genet. 1999;86(1):70-3. [PubMed:10516439]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01110Miconazoleapproved, investigational, vet_approvedunknowninhibitorDetails
DB00721Procaineapproved, investigational, vet_approvedunknownblockerDetails
DB09089TrimebutineapprovedyesinhibitorDetails