Potassium voltage-gated channel subfamily KQT member 5

Details

Name
Potassium voltage-gated channel subfamily KQT member 5
Synonyms
  • KQT-like 5
  • Potassium channel subunit alpha KvLQT5
  • Voltage-gated potassium channel subunit Kv7.5
Gene Name
KCNQ5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0004714|Potassium voltage-gated channel subfamily KQT member 5
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLL
LGTRAATLGGGGGGLRESRRGKQGARMSLLGKPLSYTSSQSCRRNVKYRRVQNYLYNVLE
RPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQIL
RMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVEKDANKEFSTYAD
ALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQ
KHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTKKEQGEASSSQKLS
FKERVRMASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQKSWSFNDRTRFRPSLRLK
SSQPKPVIDADTALGTDDVYDEKGCQCDVSVEDLTPPLKTVIRAIRIMKFHVAKRKFKET
LRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGKGQITSDKKSREKITAEHETTDDL
SMLGRVVKVEKQVQSIESKLDCLLDIYQQVLRKGSASALALASFQIPPFECEQTSDYQSP
VDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPISQ
SDGSAVAATNTIANQINTAPKPAAPTTLQIPPPLPAIKHLPRPETLHPNPAGLQESISDV
TTCLVASKENVQVAQSNLTKDRSMRKSFDMGGETLLSVCPMVPKDLGKSLSVQNLIRSTE
ELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTFDAAPQPAREAAFAS
DSLRTGRSRSSQSICKAGESTDALSLPHVKLK
Number of residues
932
Molecular Weight
102178.015
Theoretical pI
10.01
GO Classification
Functions
delayed rectifier potassium channel activity / inward rectifier potassium channel activity / voltage-gated potassium channel activity
Processes
potassium ion transmembrane transport / protein complex assembly / synaptic transmission
Components
clathrin coat / integral component of membrane / plasma membrane / voltage-gated potassium channel complex
General Function
Voltage-gated potassium channel activity
Specific Function
Probably important in the regulation of neuronal excitability. Associates with KCNQ3 to form a potassium channel which contributes to M-type current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons. May contribute, with other potassium channels, to the molecular diversity of a heterogeneous population of M-channels, varying in kinetic and pharmacological properties, which underlie this physiologically important current. Insensitive to tetraethylammonium, but inhibited by barium, linopirdine and XE991. Activated by niflumic acid and the anticonvulsant retigabine. Muscarine suppresses KCNQ5 current in Xenopus oocytes in which cloned KCNQ5 channels were coexpressed with M(1) muscarinic receptors.
Pfam Domain Function
Transmembrane Regions
126-146 157-177 201-221 230-252 267-287 326-346
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0011719|Potassium voltage-gated channel subfamily KQT member 5 (KCNQ5)
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGC
GGCGCAGCGGCGGCGGCGGCGGGCGGGGGGCGCTTGGGCAGCGGCATGAAGGATGTGGAG
TCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGG
GGCAAGCAGGGGGCCCGGATGAGCCTGCTGGGGAAGCCGCTCTCTTACACGAGTAGCCAG
AGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGC
TTGATTTTGTCAGTGTTTTCTACCATCCCTGAGCACACAAAATTGGCCTCAAGTTGCCTC
TTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAG
CCCTTCTGTGTTATAGATACCATTGTTCTTATCGCTTCAATAGCAGTTGTTTCTGCAAAA
ACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTAT
GCTCACAGCAAGGAATTAATCACAGCTTGGTACATAGGATTTTTGGTTCTTATTTTTTCG
TCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTA
ACTTGGCTGGGAAGATTGCTTTCTGCAGGCTTTGCACTCCTTGGCATTTCTTTCTTTGCA
CTTCCTGCCGGCATTCTTGGCTCAGGTTTTGCATTAAAAGTACAAGAACAACACCGCCAG
AAACACTTTGAGAAAAGAAGGAACCCAGCTGCCAACCTCATTCAGTGTGTTTGGCGTAGT
TACGCAGCTGATGAGAAATCTGTTTCCATTGCAACCTGGAAGCCACACTTGAAGGCCTTG
CACACCTGCAGCCCTACCAATCAGAAGCTAAGTTTTAAGGAGCGAGTGCGCATGGCTAGC
CCCAGGGGCCAGAGTATTAAGAGCCGACAAGCCTCAGTAGGTGACAGGAGGTCCCCAAGC
ACCGACATCACAGCCGAGGGCAGTCCCACCAAAGTGCAGAAGAGCTGGAGCTTCAACGAC
CGAACCCGCTTCCGGCCCTCGCTGCGCCTCAAAAGTTCTCAGCCAAAACCAGTGATAGAT
GCTGACACAGCCCTTGGCACTGATGATGTATATGATGAAAAAGGATGCCAGTGTGATGTA
TCAGTGGAAGACCTCACCCCACCACTTAAAACTGTCATTCGAGCTATCAGAATTATGAAA
TTTCATGTTGCAAAACGGAAGTTTAAGGAAACATTACGTCCATATGATGTAAAAGATGTC
ATTGAACAATATTCTGCTGGTCATCTGGACATGTTGTGTAGAATTAAAAGCCTTCAAACA
CGTGTTGATCAAATTCTTGGAAAAGGGCAAATCACATCAGATAAGAAGAGCCGAGAGAAA
ATAACAGCAGAACATGAGACCACAGACGATCTCAGTATGCTCGGTCGGGTGGTCAAGGTT
GAAAAACAGGTACAGTCCATAGAATCCAAGCTGGACTGCCTACTAGACATCTATCAACAG
GTCCTTCGGAAAGGCTCTGCCTCAGCCCTCGCTTTGGCTTCATTCCAGATCCCACCTTTT
GAATGTGAACAGACATCTGACTATCAAAGCCCTGTGGATAGCAAAGATCTTTCGGGTTCC
GCACAAAACAGTGGCTGCTTATCCAGATCAACTAGTGCCAACATCTCGAGAGGCCTGCAG
TTCATTCTGACGCCAAATGAGTTCAGTGCCCAGACTTTCTACGCGCTTAGCCCTACTATG
CACAGTCAAGCAACACAGGTGCCAATTAGTCAAAGCGATGGCTCAGCAGTGGCAGCCACC
AACACCATTGCAAACCAAATAAATACGGCACCCAAGCCAGCAGCCCCAACAACTTTACAG
ATCCCACCTCCTCTCCCAGCCATCAAGCATCTGCCCAGGCCAGAAACTCTGCACCCTAAC
CCTGCAGGCTTACAGGAAAGCATTTCTGACGTCACCACCTGCCTTGTTGCCTCCAAGGAA
AATGTTCAGGTTGCACAGTCAAATCTCACCAAGGACCGTTCTATGAGGAAAAGCTTTGAC
ATGGGAGGAGAAACTCTGTTGTCTGTCTGTCCCATGGTGCCGAAGGACTTGGGCAAATCT
TTGTCTGTGCAAAACCTGATCAGGTCGACCGAGGAACTGAATATACAACTTTCAGGGAGT
GAGTCAAGTGGCTCCAGAGGCAGCCAAGATTTTTACCCCAAATGGAGGGAATCCAAATTG
TTTATAACTGATGAAGAGGTGGGTCCCGAAGAGACAGAGACAGACACTTTTGATGCCGCA
CCGCAGCCTGCCAGGGAAGCTGCCTTTGCATCAGACTCTCTAAGGACTGGAAGGTCACGA
TCATCTCAGAGCATTTGTAAGGCAGGAGAAAGTACAGATGCCCTCAGCTTGCCTCATGTC
AAACTGAAATAA
Chromosome Location
6
Locus
6q14
External Identifiers
ResourceLink
UniProtKB IDQ9NR82
UniProtKB Entry NameKCNQ5_HUMAN
GenBank Gene IDAF249278
GenAtlas IDKCNQ5
HGNC IDHGNC:6299
General References
  1. Lerche C, Scherer CR, Seebohm G, Derst C, Wei AD, Busch AE, Steinmeyer K: Molecular cloning and functional expression of KCNQ5, a potassium channel subunit that may contribute to neuronal M-current diversity. J Biol Chem. 2000 Jul 21;275(29):22395-400. [PubMed:10787416]
  2. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  5. Schroeder BC, Hechenberger M, Weinreich F, Kubisch C, Jentsch TJ: KCNQ5, a novel potassium channel broadly expressed in brain, mediates M-type currents. J Biol Chem. 2000 Aug 4;275(31):24089-95. [PubMed:10816588]
  6. Wickenden AD, Zou A, Wagoner PK, Jegla T: Characterization of KCNQ5/Q3 potassium channels expressed in mammalian cells. Br J Pharmacol. 2001 Jan;132(2):381-4. [PubMed:11159685]
  7. Oliveras A, Roura-Ferrer M, Sole L, de la Cruz A, Prieto A, Etxebarria A, Manils J, Morales-Cano D, Condom E, Soler C, Cogolludo A, Valenzuela C, Villarroel A, Comes N, Felipe A: Functional assembly of Kv7.1/Kv7.5 channels with emerging properties on vascular muscle physiology. Arterioscler Thromb Vasc Biol. 2014 Jul;34(7):1522-30. doi: 10.1161/ATVBAHA.114.303801. Epub 2014 May 22. [PubMed:24855057]
  8. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04953Ezogabineapproved, investigationalunknownDetails
DB06089ICA-105665investigationalunknownDetails
DB00996Gabapentinapproved, investigationalunknownactivatorDetails
DB01069Promethazineapproved, investigationalunknowninducerDetails