Histone deacetylase 6

Details

Name
Histone deacetylase 6
Synonyms
  • 3.5.1.98
  • HD6
  • KIAA0901
Gene Name
HDAC6
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037198|Histone deacetylase 6
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
QAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSR
TGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH
SAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMF
EDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWH
RLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEG
GYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSET
AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
ILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQ
TPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEA
AGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQ
ENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN
IAHQNKFGEDMPHPH
Number of residues
1215
Molecular Weight
131418.19
Theoretical pI
4.98
GO Classification
Functions
alpha-tubulin binding / beta-catenin binding / core promoter binding / dynein complex binding / enzyme binding / histone deacetylase activity / histone deacetylase binding / Hsp90 protein binding / microtubule binding / misfolded protein binding / NAD-dependent histone deacetylase activity (H3-K14 specific) / polyubiquitin binding / tau protein binding / tubulin deacetylase activity / ubiquitin protein ligase binding / zinc ion binding
Processes
aggresome assembly / cellular response to heat / cellular response to hydrogen peroxide / cellular response to misfolded protein / cellular response to topologically incorrect protein / histone deacetylation / Hsp90 deacetylation / intracellular protein transport / lysosome localization / macroautophagy / misfolded or incompletely synthesized protein catabolic process / mitochondrion localization / mitophagy in response to mitochondrial depolarization / negative regulation of hydrogen peroxide metabolic process / negative regulation of microtubule depolymerization / negative regulation of oxidoreductase activity / negative regulation of protein complex disassembly / negative regulation of proteolysis / negative regulation of transcription, DNA-templated / organelle organization / peptidyl-lysine deacetylation / polyubiquitinated misfolded protein transport / positive regulation of chaperone-mediated protein complex assembly / positive regulation of epithelial cell migration / positive regulation of hydrogen peroxide-mediated programmed cell death / positive regulation of receptor biosynthetic process / positive regulation of signal transduction / protein complex disassembly / protein deacetylation / protein polyubiquitination / regulation of androgen receptor signaling pathway / regulation of establishment of protein localization / regulation of fat cell differentiation / regulation of gene expression, epigenetic / regulation of microtubule-based movement / regulation of protein stability / regulation of receptor activity / response to growth factor / response to misfolded protein / response to organic substance / response to toxic substance / transcription, DNA-templated / tubulin deacetylation / ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
Components
aggresome / axon / caveola / cell leading edge / cytoplasm / cytoplasmic microtubule / cytosol / dendrite / histone deacetylase complex / inclusion body / microtubule / microtubule associated complex / nucleus / perikaryon / perinuclear region of cytoplasm
General Function
Zinc ion binding
Specific Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity). Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer.In addition to its protein deacetylase activity, plays a key role in the degradation of misfolded proteins: when misfolded proteins are too abundant to be degraded by the chaperone refolding system and the ubiquitin-proteasome, mediates the transport of misfolded proteins to a cytoplasmic juxtanuclear structure called aggresome. Probably acts as an adapter that recognizes polyubiquitinated misfolded proteins and target them to the aggresome, facilitating their clearance by autophagy.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Nucleus
Gene sequence
>lcl|BSEQ0021857|Histone deacetylase 6 (HDAC6)
ATGACCTCAACCGGCCAGGATTCCACCACAACCAGGCAGCGAAGAAGTAGGCAGAACCCC
CAGTCGCCCCCTCAGGACTCCAGTGTCACTTCGAAGCGAAATATTAAAAAGGGAGCCGTT
CCCCGCTCTATCCCCAATCTAGCGGAGGTAAAGAAGAAAGGCAAAATGAAGAAGCTCGGC
CAAGCAATGGAAGAAGACCTAATCGTGGGACTGCAAGGGATGGATCTGAACCTTGAGGCT
GAAGCACTGGCTGGCACTGGCTTGGTGTTGGATGAGCAGTTAAATGAATTCCATTGCCTC
TGGGATGACAGCTTCCCGGAAGGCCCTGAGCGGCTCCATGCCATCAAGGAGCAACTGATC
CAGGAGGGCCTCCTAGATCGCTGCGTGTCCTTTCAGGCCCGGTTTGCTGAAAAGGAAGAG
CTGATGTTGGTTCACAGCCTAGAATATATTGATCTGATGGAAACAACCCAGTACATGAAT
GAGGGAGAACTCCGTGTCCTAGCAGACACCTACGACTCAGTTTATCTGCATCCGAACTCA
TACTCCTGTGCCTGCCTGGCCTCAGGCTCTGTCCTCAGGCTGGTGGATGCGGTCCTGGGG
GCTGAGATCCGGAATGGCATGGCCATCATTAGGCCTCCTGGACATCACGCCCAGCACAGT
CTTATGGATGGCTATTGCATGTTCAACCACGTGGCTGTGGCAGCCCGCTATGCTCAACAG
AAACACCGCATCCGGAGGGTCCTTATCGTAGATTGGGATGTGCACCACGGTCAAGGAACA
CAGTTCACCTTCGACCAGGACCCCAGTGTCCTCTATTTCTCCATCCACCGCTACGAGCAG
GGTAGGTTCTGGCCCCACCTGAAGGCCTCTAACTGGTCCACCACAGGTTTCGGCCAAGGC
CAAGGATATACCATCAATGTGCCTTGGAACCAGGTGGGGATGCGGGATGCTGACTACATT
GCTGCTTTCCTGCACGTCCTGCTGCCAGTCGCCCTCGAGTTCCAGCCTCAGCTGGTCCTG
GTGGCTGCTGGATTTGATGCCCTGCAAGGGGACCCCAAGGGTGAGATGGCCGCCACTCCG
GCAGGGTTCGCCCAGCTAACCCACCTGCTCATGGGTCTGGCAGGAGGCAAGCTGATCCTG
TCTCTGGAGGGTGGCTACAACCTCCGCGCCCTGGCTGAAGGCGTCAGTGCTTCGCTCCAC
ACCCTTCTGGGAGACCCTTGCCCCATGCTGGAGTCACCTGGTGCCCCCTGCCGGAGTGCC
CAGGCTTCAGTTTCCTGTGCTCTGGAAGCCCTTGAGCCCTTCTGGGAGGTTCTTGTGAGA
TCAACTGAGACCGTGGAGAGGGACAACATGGAGGAGGACAATGTAGAGGAGAGCGAGGAG
GAAGGACCCTGGGAGCCCCCTGTGCTCCCAATCCTGACATGGCCAGTGCTACAGTCTCGC
ACAGGGCTGGTCTATGACCAAAATATGATGAATCACTGCAACTTGTGGGACAGCCACCAC
CCTGAGGTACCCCAGCGCATCTTGCGGATCATGTGCCGTCTGGAGGAGCTGGGCCTTGCC
GGGCGCTGCCTCACCCTGACACCGCGCCCTGCCACAGAGGCTGAGCTGCTCACCTGTCAC
AGTGCTGAGTACGTGGGTCATCTCCGGGCCACAGAGAAAATGAAAACCCGGGAGCTGCAC
CGTGAGAGTTCCAACTTTGACTCCATCTATATCTGCCCCAGTACCTTCGCCTGTGCACAG
CTTGCCACTGGCGCTGCCTGCCGCCTGGTGGAGGCTGTGCTCTCAGGAGAGGTTCTGAAT
GGTGCTGCTGTGGTGCGTCCCCCAGGACACCACGCAGAGCAGGATGCAGCTTGCGGTTTT
TGCTTTTTCAACTCTGTGGCTGTGGCTGCTCGCCATGCCCAGACTATCAGTGGGCATGCC
CTACGGATCCTGATTGTGGATTGGGATGTCCACCACGGTAATGGAACTCAGCACATGTTT
GAGGATGACCCCAGTGTGCTATATGTGTCCCTGCACCGCTATGATCATGGCACCTTCTTC
CCCATGGGGGATGAGGGTGCCAGCAGCCAGATCGGCCGGGCTGCGGGCACAGGCTTCACC
GTCAACGTGGCATGGAACGGGCCCCGCATGGGTGATGCTGACTACCTAGCTGCCTGGCAT
CGCCTGGTGCTTCCCATTGCCTACGAGTTTAACCCAGAACTGGTGCTGGTCTCAGCTGGC
TTTGATGCTGCACGGGGGGATCCGCTGGGGGGCTGCCAGGTGTCACCTGAGGGTTATGCC
CACCTCACCCACCTGCTGATGGGCCTTGCCAGTGGCCGCATTATCCTTATCCTAGAGGGT
GGCTATAACCTGACATCCATCTCAGAGTCCATGGCTGCCTGCACTCGCTCCCTCCTTGGA
GACCCACCACCCCTGCTGACCCTGCCACGGCCCCCACTATCAGGGGCCCTGGCCTCAATC
ACTGAGACCATCCAAGTCCATCGCAGATACTGGCGCAGCTTACGGGTCATGAAGGTAGAA
GACAGAGAAGGACCCTCCAGTTCTAAGTTGGTCACCAAGAAGGCACCCCAACCAGCCAAA
CCTAGGTTAGCTGAGCGGATGACCACACGAGAAAAGAAGGTTCTGGAAGCAGGCATGGGG
AAAGTCACCTCGGCATCATTTGGGGAAGAGTCCACTCCAGGCCAGACTAACTCAGAGACA
GCTGTGGTGGCCCTCACTCAGGACCAGCCCTCAGAGGCAGCCACAGGGGGAGCCACTCTG
GCCCAGACCATTTCTGAGGCAGCCATTGGGGGAGCCATGCTGGGCCAGACCACCTCAGAG
GAGGCTGTCGGGGGAGCCACTCCGGACCAGACCACCTCAGAGGAGACTGTGGGAGGAGCC
ATTCTGGACCAGACCACCTCAGAGGATGCTGTTGGGGGAGCCACGCTGGGCCAGACTACC
TCAGAGGAGGCTGTAGGAGGAGCTACACTGGCCCAGACCACCTCGGAGGCAGCCATGGAG
GGAGCCACACTGGACCAGACTACGTCAGAGGAGGCTCCAGGGGGCACCGAGCTGATCCAA
ACTCCTCTAGCCTCGAGCACAGACCACCAGACCCCCCCAACCTCACCTGTGCAGGGAACT
ACACCCCAGATATCTCCCAGTACACTGATTGGGAGTCTCAGGACCTTGGAGCTAGGCAGC
GAATCTCAGGGGGCCTCAGAATCTCAGGCCCCAGGAGAGGAGAACCTACTAGGAGAGGCA
GCTGGAGGTCAGGACATGGCTGATTCGATGCTGATGCAGGGATCTAGGGGCCTCACTGAT
CAGGCCATATTTTATGCTGTGACACCACTGCCCTGGTGTCCCCATTTGGTGGCAGTATGC
CCCATACCTGCAGCAGGCCTAGACGTGACCCAACCTTGTGGGGACTGTGGAACAATCCAA
GAGAATTGGGTGTGTCTCTCTTGCTATCAGGTCTACTGTGGTCGTTACATCAATGGCCAC
ATGCTCCAACACCATGGAAATTCTGGACACCCGCTGGTCCTCAGCTACATCGACCTGTCA
GCCTGGTGTTACTACTGTCAGGCCTATGTCCACCACCAGGCTCTCCTAGATGTGAAGAAC
ATCGCCCACCAGAACAAGTTTGGGGAGGATATGCCCCACCCACACTAA
Chromosome Location
X
Locus
Xp11.23
External Identifiers
ResourceLink
UniProtKB IDQ9UBN7
UniProtKB Entry NameHDAC6_HUMAN
GenBank Protein ID4754911
GenBank Gene IDAF132609
GenAtlas IDHDAC6
HGNC IDHGNC:14064
General References
  1. Grozinger CM, Hassig CA, Schreiber SL: Three proteins define a class of human histone deacetylases related to yeast Hda1p. Proc Natl Acad Sci U S A. 1999 Apr 27;96(9):4868-73. [PubMed:10220385]
  2. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. [PubMed:10048485]
  3. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Amann JM, Nip J, Strom DK, Lutterbach B, Harada H, Lenny N, Downing JR, Meyers S, Hiebert SW: ETO, a target of t(8;21) in acute leukemia, makes distinct contacts with multiple histone deacetylases and binds mSin3A through its oligomerization domain. Mol Cell Biol. 2001 Oct;21(19):6470-83. [PubMed:11533236]
  6. Gao L, Cueto MA, Asselbergs F, Atadja P: Cloning and functional characterization of HDAC11, a novel member of the human histone deacetylase family. J Biol Chem. 2002 Jul 12;277(28):25748-55. Epub 2002 Apr 10. [PubMed:11948178]
  7. Kirsh O, Seeler JS, Pichler A, Gast A, Muller S, Miska E, Mathieu M, Harel-Bellan A, Kouzarides T, Melchior F, Dejean A: The SUMO E3 ligase RanBP2 promotes modification of the HDAC4 deacetylase. EMBO J. 2002 Jun 3;21(11):2682-91. [PubMed:12032081]
  8. Hook SS, Orian A, Cowley SM, Eisenman RN: Histone deacetylase 6 binds polyubiquitin through its zinc finger (PAZ domain) and copurifies with deubiquitinating enzymes. Proc Natl Acad Sci U S A. 2002 Oct 15;99(21):13425-30. Epub 2002 Sep 27. [PubMed:12354939]
  9. Hubbert C, Guardiola A, Shao R, Kawaguchi Y, Ito A, Nixon A, Yoshida M, Wang XF, Yao TP: HDAC6 is a microtubule-associated deacetylase. Nature. 2002 May 23;417(6887):455-8. [PubMed:12024216]
  10. North BJ, Marshall BL, Borra MT, Denu JM, Verdin E: The human Sir2 ortholog, SIRT2, is an NAD+-dependent tubulin deacetylase. Mol Cell. 2003 Feb;11(2):437-44. [PubMed:12620231]
  11. Pugacheva EN, Jablonski SA, Hartman TR, Henske EP, Golemis EA: HEF1-dependent Aurora A activation induces disassembly of the primary cilium. Cell. 2007 Jun 29;129(7):1351-63. [PubMed:17604723]
  12. Ohoka N, Hattori T, Kitagawa M, Onozaki K, Hayashi H: Critical and functional regulation of CHOP (C/EBP homologous protein) through the N-terminal portion. J Biol Chem. 2007 Dec 7;282(49):35687-94. Epub 2007 Sep 14. [PubMed:17872950]
  13. Olzmann JA, Li L, Chudaev MV, Chen J, Perez FA, Palmiter RD, Chin LS: Parkin-mediated K63-linked polyubiquitination targets misfolded DJ-1 to aggresomes via binding to HDAC6. J Cell Biol. 2007 Sep 10;178(6):1025-38. [PubMed:17846173]
  14. Nahhas F, Dryden SC, Abrams J, Tainsky MA: Mutations in SIRT2 deacetylase which regulate enzymatic activity but not its interaction with HDAC6 and tubulin. Mol Cell Biochem. 2007 Sep;303(1-2):221-30. Epub 2007 May 22. [PubMed:17516032]
  15. Loktev AV, Zhang Q, Beck JS, Searby CC, Scheetz TE, Bazan JF, Slusarski DC, Sheffield VC, Jackson PK, Nachury MV: A BBSome subunit links ciliogenesis, microtubule stability, and acetylation. Dev Cell. 2008 Dec;15(6):854-65. doi: 10.1016/j.devcel.2008.11.001. [PubMed:19081074]
  16. Kalveram B, Schmidtke G, Groettrup M: The ubiquitin-like modifier FAT10 interacts with HDAC6 and localizes to aggresomes under proteasome inhibition. J Cell Sci. 2008 Dec 15;121(Pt 24):4079-88. doi: 10.1242/jcs.035006. Epub 2008 Nov 25. [PubMed:19033385]
  17. Zhuang Y, Nguyen HT, Lasky JA, Cao S, Li C, Hu J, Guo X, Burow ME, Shan B: Requirement of a novel splicing variant of human histone deacetylase 6 for TGF-beta1-mediated gene activation. Biochem Biophys Res Commun. 2010 Feb 19;392(4):608-13. doi: 10.1016/j.bbrc.2010.01.091. Epub 2010 Jan 25. [PubMed:20102703]
  18. Wickstrom SA, Masoumi KC, Khochbin S, Fassler R, Massoumi R: CYLD negatively regulates cell-cycle progression by inactivating HDAC6 and increasing the levels of acetylated tubulin. EMBO J. 2010 Jan 6;29(1):131-44. doi: 10.1038/emboj.2009.317. Epub 2009 Nov 5. [PubMed:19893491]
  19. Simon D, Laloo B, Barillot M, Barnetche T, Blanchard C, Rooryck C, Marche M, Burgelin I, Coupry I, Chassaing N, Gilbert-Dussardier B, Lacombe D, Grosset C, Arveiler B: A mutation in the 3'-UTR of the HDAC6 gene abolishing the post-transcriptional regulation mediated by hsa-miR-433 is linked to a new form of dominant X-linked chondrodysplasia. Hum Mol Genet. 2010 May 15;19(10):2015-27. doi: 10.1093/hmg/ddq083. Epub 2010 Feb 24. [PubMed:20181727]
  20. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  21. Kang HJ, Lee MH, Kang HL, Kim SH, Ahn JR, Na H, Na TY, Kim YN, Seong JK, Lee MO: Differential regulation of estrogen receptor alpha expression in breast cancer cells by metastasis-associated protein 1. Cancer Res. 2014 Mar 1;74(5):1484-94. doi: 10.1158/0008-5472.CAN-13-2020. Epub 2014 Jan 10. [PubMed:24413532]
  22. Balasubramanian A, Kawahara G, Gupta VA, Rozkalne A, Beauvais A, Kunkel LM, Gussoni E: Fam65b is important for formation of the HDAC6-dysferlin protein complex during myogenic cell differentiation. FASEB J. 2014 Jul;28(7):2955-69. doi: 10.1096/fj.13-246470. Epub 2014 Mar 31. [PubMed:24687993]
  23. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02546Vorinostatapproved, investigationalyesinhibitorDetails
DB05223PracinostatinvestigationalunknownDetails
DB06176Romidepsinapproved, investigationalnoinhibitorDetails
DB13346Bufexamacapproved, withdrawnunknowninhibitorDetails
DB05015Belinostatapproved, investigationalyesinhibitorDetails
DB06603Panobinostatapproved, investigationalyesinhibitorDetails