ATP-sensitive inward rectifier potassium channel 14

Details

Name
ATP-sensitive inward rectifier potassium channel 14
Synonyms
  • Inward rectifier K(+) channel Kir2.4
  • IRK-4
  • IRK4
  • Potassium channel, inwardly rectifying subfamily J member 14
Gene Name
KCNJ14
Organism
Humans
Amino acid sequence
>lcl|BSEQ0020813|ATP-sensitive inward rectifier potassium channel 14
MGLARALRRLSGALDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKDGHCN
VRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAA
PPPPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFV
VGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPR
VTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELV
VILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPV
CSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGA
ASPRVLTPTLALTLPP
Number of residues
436
Molecular Weight
47844.995
Theoretical pI
Not Available
GO Classification
Functions
inward rectifier potassium channel activity
Processes
cardiac conduction / potassium ion import / regulation of ion transmembrane transport
Components
dendrite / neuronal cell body / plasma membrane / voltage-gated potassium channel complex
General Function
Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. KCNJ14 gives rise to low-conductance channels with a low affinity to the channel blockers Barium and Cesium (By similarity).
Specific Function
Inward rectifier potassium channel activity
Pfam Domain Function
Transmembrane Regions
87-111 162-183
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0020814|ATP-sensitive inward rectifier potassium channel 14 (KCNJ14)
ATGGGCCTGGCCAGGGCCCTACGCCGCCTCAGCGGCGCCCTGGATTCGGGAGACAGCCGG
GCGGGCGATGAAGAGGAGGCCGGGCCCGGGTTGTGCCGCAACGGGTGGGCGCCGGCACCG
GTGCAGTCACCCGTGGGCCGGCGCCGCGGTCGCTTCGTCAAGAAAGACGGGCACTGCAAC
GTGCGTTTCGTAAACCTGGGTGGCCAGGGCGCGCGCTACCTGAGCGACCTGTTCACCACA
TGCGTGGACGTGCGCTGGCGCTGGATGTGCCTGCTCTTCTCCTGCTCCTTCCTCGCCTCC
TGGCTGCTCTTCGGCCTGGCCTTCTGGCTCATTGCCTCGCTGCACGGCGACCTGGCCGCC
CCGCCACCGCCCGCGCCCTGCTTCTCACACGTGGCCAGCTTCCTGGCCGCCTTCCTCTTC
GCGCTGGAGACGCAGACGTCCATCGGCTACGGCGTGCGCAGCGTCACCGAGGAGTGCCCG
GCCGCTGTGGCCGCCGTGGTGCTGCAGTGCATTGCCGGCTGCGTGCTCGACGCCTTCGTC
GTGGGTGCTGTCATGGCCAAGATGGCCAAACCCAAGAAGCGCAACGAGACGCTGGTCTTC
AGCGAGAACGCCGTCGTGGCGCTGCGCGACCACCGCCTCTGCCTCATGTGGCGCGTCGGC
AACCTGCGCCGCAGCCACCTGGTCGAGGCCCACGTGCGTGCCCAGCTGCTGCAGCCCCGT
GTGACCCCAGAGGGTGAGTACATCCCGCTGGACCACCAGGATGTGGATGTGGGCTTTGAT
GGAGGCACCGATCGTATCTTCCTCGTGTCCCCCATCACCATCGTCCATGAGATCGACTCT
GCCAGTCCTCTGTATGAGCTAGGACGTGCCGAGCTGGCCAGGGCTGACTTTGAGCTGGTG
GTCATTCTCGAGGGGATGGTTGAGGCCACAGCCATGACCACACAGTGTCGCTCGTCCTAC
CTCCCTGGTGAACTGCTCTGGGGCCATCGTTTTGAGCCAGTTCTCTTCCAGCGTGGCTCC
CAGTATGAGGTCGACTATCGCCACTTCCATCGCACTTATGAGGTCCCAGGGACACCGGTC
TGCAGTGCTAAGGAGCTGGATGAACGGGCAGAGCAGGCTTCCCACAGCCTCAAGTCTAGT
TTCCCCGGCTCTCTGACTGCATTTTGTTATGAGAATGAACTTGCTCTGAGCTGCTGCCAG
GAGGAAGATGAGGACGATGAGACTGAGGAAGGGAATGGGGTGGAAACAGAAGATGGGGCT
GCTAGCCCCCGAGTTCTCACACCAACCCTGGCGCTGACCCTGCCTCCATGA
Chromosome Location
19
Locus
19q13.33
External Identifiers
ResourceLink
UniProtKB IDQ9UNX9
UniProtKB Entry NameKCJ14_HUMAN
HGNC IDHGNC:6260
General References
  1. Hughes BA, Kumar G, Yuan Y, Swaminathan A, Yan D, Sharma A, Plumley L, Yang-Feng TL, Swaroop A: Cloning and functional expression of human retinal kir2.4, a pH-sensitive inwardly rectifying K(+) channel. Am J Physiol Cell Physiol. 2000 Sep;279(3):C771-84. [PubMed:10942728]
  2. Topert C, Doring F, Derst C, Daut J, Grzeschik KH, Karschin A: Cloning, structure and assignment to chromosome 19q13 of the human Kir2.4 inwardly rectifying potassium channel gene (KCNJ14). Mamm Genome. 2000 Mar;11(3):247-9. [PubMed:10723734]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01392Yohimbineapproved, investigational, vet_approvedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesantagonistDetails
DB00243Ranolazineapproved, investigationalunknowninhibitorDetails
DB04855DronedaroneapprovedyesinhibitorDetails