Proteinase-activated receptor 1
Details
- Name
- Proteinase-activated receptor 1
- Synonyms
- CF2R
- Coagulation factor II receptor
- PAR-1
- PAR1
- Thrombin receptor
- TR
- Gene Name
- F2R
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0010652|Proteinase-activated receptor 1 MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY KKLLT
- Number of residues
- 425
- Molecular Weight
- 47439.83
- Theoretical pI
- 8.33
- GO Classification
- FunctionsG-protein alpha-subunit binding / G-protein beta-subunit binding / G-protein coupled receptor activity / receptor binding / thrombin receptor activityProcessesactivation of cysteine-type endopeptidase activity involved in apoptotic process / activation of MAPKK activity / anatomical structure morphogenesis / blood coagulation / connective tissue replacement involved in inflammatory response wound healing / establishment of synaptic specificity at neuromuscular junction / G-protein coupled receptor signaling pathway / homeostasis of number of cells within a tissue / inflammatory response / negative regulation of cell proliferation / negative regulation of glomerular filtration / negative regulation of neuron apoptotic process / negative regulation of renin secretion into blood stream / phospholipase C-activating G-protein coupled receptor signaling pathway / platelet activation / platelet dense granule organization / positive regulation of blood coagulation / positive regulation of calcium ion transport / positive regulation of cell migration / positive regulation of cell proliferation / positive regulation of collagen biosynthetic process / positive regulation of cysteine-type endopeptidase activity involved in apoptotic process / positive regulation of cytosolic calcium ion concentration / positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway / positive regulation of ERK1 and ERK2 cascade / positive regulation of I-kappaB kinase/NF-kappaB signaling / positive regulation of interleukin-6 secretion / positive regulation of interleukin-8 secretion / positive regulation of JAK-STAT cascade / positive regulation of MAPK cascade / positive regulation of phosphatidylinositol 3-kinase signaling / positive regulation of release of sequestered calcium ion into cytosol / positive regulation of Rho protein signal transduction / positive regulation of smooth muscle contraction / positive regulation of transcription, DNA-templated / positive regulation of vasoconstriction / protein kinase C-activating G-protein coupled receptor signaling pathway / regulation of blood coagulation / regulation of interleukin-1 beta production / regulation of sensory perception of pain / release of sequestered calcium ion into cytosol / response to lipopolysaccharide / response to wounding / STAT protein import into nucleus / tyrosine phosphorylation of STAT proteinComponentscaveola / cell surface / cytosol / early endosome / extracellular region / Golgi apparatus / integral component of plasma membrane / late endosome / neuromuscular junction / plasma membrane / platelet dense tubular network / postsynaptic membrane
- General Function
- Thrombin receptor activity
- Specific Function
- High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation and in vascular development.
- Pfam Domain Function
- 7tm_1 (PF00001)
- Transmembrane Regions
- 103-128 138-157 177-198 219-239 269-288 312-334 351-374
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0010653|Proteinase-activated receptor 1 (F2R) ATGGGGCCGCGGCGGCTGCTGCTGGTGGCCGCCTGCTTCAGTCTGTGCGGCCCGCTGTTG TCTGCCCGCACCCGGGCCCGCAGGCCAGAATCAAAAGCAACAAATGCCACCTTAGATCCC CGGTCATTTCTTCTCAGGAACCCCAATGATAAATATGAACCATTTTGGGAGGATGAGGAG AAAAATGAAAGTGGGTTAACTGAATACAGATTAGTCTCCATCAATAAAAGCAGTCCTCTT CAAAAACAACTTCCTGCATTCATCTCAGAAGATGCCTCCGGATATTTGACCAGCTCCTGG CTGACACTCTTTGTCCCATCTGTGTACACCGGAGTGTTTGTAGTCAGCCTCCCACTAAAC ATCATGGCCATCGTTGTGTTCATCCTGAAAATGAAGGTCAAGAAGCCGGCGGTGGTGTAC ATGCTGCACCTGGCCACGGCAGATGTGCTGTTTGTGTCTGTGCTCCCCTTTAAGATCAGC TATTACTTTTCCGGCAGTGATTGGCAGTTTGGGTCTGAATTGTGTCGCTTCGTCACTGCA GCATTTTACTGTAACATGTACGCCTCTATCTTGCTCATGACAGTCATAAGCATTGACCGG TTTCTGGCTGTGGTGTATCCCATGCAGTCCCTCTCCTGGCGTACTCTGGGAAGGGCTTCC TTCACTTGTCTGGCCATCTGGGCTTTGGCCATCGCAGGGGTAGTGCCTCTGCTCCTCAAG GAGCAAACCATCCAGGTGCCCGGGCTCAACATCACTACCTGTCATGATGTGCTCAATGAA ACCCTGCTCGAAGGCTACTATGCCTACTACTTCTCAGCCTTCTCTGCTGTCTTCTTTTTT GTGCCGCTGATCATTTCCACGGTCTGTTATGTGTCTATCATTCGATGTCTTAGCTCTTCC GCAGTTGCCAACCGCAGCAAGAAGTCCCGGGCTTTGTTCCTGTCAGCTGCTGTTTTCTGC ATCTTCATCATTTGCTTCGGACCCACAAACGTCCTCCTGATTGCGCATTACTCATTCCTT TCTCACACTTCCACCACAGAGGCTGCCTACTTTGCCTACCTCCTCTGTGTCTGTGTCAGC AGCATAAGCTGCTGCATCGACCCCCTAATTTACTATTACGCTTCCTCTGAGTGCCAGAGG TACGTCTACAGTATCTTATGCTGCAAAGAAAGTTCCGATCCCAGCAGTTATAACAGCAGT GGGCAGTTGATGGCAAGTAAAATGGATACCTGCTCTAGTAACCTGAATAACAGCATATAC AAAAAGCTGTTAACTTAG
- Chromosome Location
- 5
- Locus
- 5q13
- External Identifiers
Resource Link UniProtKB ID P25116 UniProtKB Entry Name PAR1_HUMAN GenBank Protein ID 339677 GenBank Gene ID M62424 GenAtlas ID F2R HGNC ID HGNC:3537 - General References
- Vu TK, Hung DT, Wheaton VI, Coughlin SR: Molecular cloning of a functional thrombin receptor reveals a novel proteolytic mechanism of receptor activation. Cell. 1991 Mar 22;64(6):1057-68. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Shapiro MJ, Trejo J, Zeng D, Coughlin SR: Role of the thrombin receptor's cytoplasmic tail in intracellular trafficking. Distinct determinants for agonist-triggered versus tonic internalization and intracellular localization. J Biol Chem. 1996 Dec 20;271(51):32874-80. [Article]
- Kahn ML, Nakanishi-Matsui M, Shapiro MJ, Ishihara H, Coughlin SR: Protease-activated receptors 1 and 4 mediate activation of human platelets by thrombin. J Clin Invest. 1999 Mar;103(6):879-87. [Article]
- Zania P, Gourni D, Aplin AC, Nicosia RF, Flordellis CS, Maragoudakis ME, Tsopanoglou NE: Parstatin, the cleaved peptide on proteinase-activated receptor 1 activation, is a potent inhibitor of angiogenesis. J Pharmacol Exp Ther. 2009 Feb;328(2):378-89. doi: 10.1124/jpet.108.145664. Epub 2008 Nov 6. [Article]
- Zampatis DE, Rutz C, Furkert J, Schmidt A, Wustenhagen D, Kubick S, Tsopanoglou NE, Schulein R: The protease-activated receptor 1 possesses a functional and cleavable signal peptide which is necessary for receptor expression. FEBS Lett. 2012 Jul 30;586(16):2351-9. doi: 10.1016/j.febslet.2012.05.042. Epub 2012 May 31. [Article]
- Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [Article]
- Mathews II, Padmanabhan KP, Ganesh V, Tulinsky A, Ishii M, Chen J, Turck CW, Coughlin SR, Fenton JW 2nd: Crystallographic structures of thrombin complexed with thrombin receptor peptides: existence of expected and novel binding modes. Biochemistry. 1994 Mar 22;33(11):3266-79. [Article]