Cytochrome b6
Details
- Name
- Cytochrome b6
- Synonyms
- Not Available
- Gene Name
- petB
- Organism
- Mastigocladus laminosus
- Amino acid sequence
>lcl|BSEQ0011769|Cytochrome b6 MANVYDWFQERLEIQALADDVTSKYVPPHVNIFYCLGGITLTCFLIQFATGFAMTFYYKP TVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWIS GVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSSVGQATL TRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGPL
- Number of residues
- 215
- Molecular Weight
- 24226.45
- Theoretical pI
- 8.94
- GO Classification
- Functionselectron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity / heme binding / iron ion binding / oxidoreductase activityProcessesphotosynthesis / respiratory electron transport chainComponentsintegral component of membrane / thylakoid membrane
- General Function
- Oxidoreductase activity
- Specific Function
- Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
- Pfam Domain Function
- Cytochrom_B_N_2 (PF13631)
- Transmembrane Regions
- 32-52 90-110 116-136 186-206
- Cellular Location
- Cellular thylakoid membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P83791 UniProtKB Entry Name CYB6_MASLA - General References
- Whitelegge JP, Zhang H, Aguilera R, Taylor RM, Cramer WA: Full subunit coverage liquid chromatography electrospray ionization mass spectrometry (LCMS+) of an oligomeric membrane protein: cytochrome b(6)f complex from spinach and the cyanobacterium Mastigocladus laminosus. Mol Cell Proteomics. 2002 Oct;1(10):816-27. [Article]
- Kurisu G, Zhang H, Smith JL, Cramer WA: Structure of the cytochrome b6f complex of oxygenic photosynthesis: tuning the cavity. Science. 2003 Nov 7;302(5647):1009-14. Epub 2003 Oct 2. [Article]