You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameBotulinum Toxin Type B
Accession NumberDB00042  (BIOD00070, BTD00070)
TypeBiotech
GroupsApproved
Description

Neurotoxin produced by fermentation of clostridium botulinum type B. The protein exists in noncovalent association with hemagglutinin and nonhemagglutinin proteins as a neurotoxin complex. The neurotoxin complex is recovered from the fermentation process and purified through a series of precipitation and chromatography steps.

Protein structureDb00042
Protein chemical formulaNot Available
Protein average weight150804.0 Da
Sequences
>Botulinum neurotoxin type B - Clostridium botulinum
MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERYTFGYKPEDFN
KSSGIFNRDVCEYYDPDYLNTNDKKNIFLQTMIKLFNRIKSKPLGEKLLEMIINGIPYLG
DRRVPLEEFNTNIASVTVNKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNH
FASREGFGGIMQMKFCPEYVSVFNNVQENKGASIFNRRGYFSDPALILMHELIHVLHGLY
GIKVDDLPIVPNEKKFFMQSTDAIQAEELYTFGGQDPSIITPSTDKSIYDKVLQNFRGIV
DRLNKVLVCISDPNININIYKNKFKDKYKFVEDSEGKYSIDVESFDKLYKSLMFGFTETN
IAENYKIKTRASYFSDSLPPVKIKNLLDNEIYTIEEGFNISDKDMEKEYRGQNKAINKQA
YEEISKEHLAVYKIQMCKSVKAPGICIDVDNEDLFFIADKNSFSDDLSKNERIEYNTQSN
YIENDFPINELILDTDLISKIELPSENTESLTDFNVDVPVYEKQPAIKKIFTDENTIFQY
LYSQTFPLDIRDISLTSSFDDALLFSNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIVND
FVIEANKSNTMDKIADISLIVPYIGLALNVGNETAKGNFENAFEIAGASILLEFIPELLI
PVVGAFLLESYIDNKNKIIKTIDNALTKRNEKWSDMYGLIVAQWLSTVNTQFYTIKEGMY
KALNYQAQALEEIIKYRYNIYSEKEKSNINIDFNDINSKLNEGINQAIDNINNFINGCSV
SYLMKKMIPLAVEKLLDFDNTLKKNLLNYIDENKLYLIGSAEYEKSKVNKYLKTIMPFDL
SIYTNDTILIEMFNKYNSEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFK
LTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNS
GWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYING
KLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSY
SEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLY
IGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEKLFLAPISD
SDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCIS
KWYLKEVKRKPYNLKLGCNWQFIPKDEGWTE
Download FASTA Format
Synonyms
Botulinum neurotoxin type B precursor
BTX-B
RimabotulinumtoxinB
External Identifiers Not Available
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Myoblocinjection, solution2500 [USP'U]/.5mLintramuscularSolstice Neurosciences, LLC2000-12-08Not applicableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Myoblocsolution5000 unitintramuscularSolstice Neurosciences LlcNot applicableNot applicableCanada 5f16b84899037e23705f146ff57e3794121879cb055f0954756d94bc690476b4
Myoblocinjection, solution10000 [USP'U]/2mLintramuscularSolstice Neurosciences, LLC2000-12-08Not applicableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Myoblocinjection, solution5000 [USP'U]/mLintramuscularSolstice Neurosciences, LLC2000-12-08Not applicableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Generic Prescription ProductsNot Available
Over the Counter ProductsNot Available
International Brands
NameCompany
NeuroblocSolstice Neurosciences
Brand mixturesNot Available
SaltsNot Available
Categories
CAS number93384-44-2
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor the treatment of patients with cervical dystonia to reduce the severity of abnormal head position and neck pain associated with cervical dystonia.
PharmacodynamicsBotulinum Toxin Type B inhibits acetylcholine release at the neuromuscular junction via a three stage process: 1) Heavy Chain mediated neurospecific binding of the toxin, 2) internalization of the toxin by receptor-mediated endocytosis, and 3) ATP and pH dependent translocation of the Light Chain to the neuronal cytosol where it acts as a zinc-dependent endoprotease cleaving polypeptides essential for neurotransmitter release.
Mechanism of actionBotulinum Toxin Type B binds to and cleaves the synaptic Vesicle Associated Membrane Protein (VAMP, also known as synaptobrevin) which is a component of the protein complex responsible for docking and fusion of the synaptic vesicle to the presynaptic membrane, a necessary step to neurotransmitter release.
AbsorptionThough pharmacokinetic or ADME studies were not performed, Botulinum Toxin Type B is not expected to be present in the peripheral blood at measurable levels following IM injection at the recommended doses.
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityOne unit of Botulinum Toxin Type B corresponds to the calculated median lethal intraperitoneal dose (LD50) in mice.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionintramuscular10000 [USP'U]/2mL
Injection, solutionintramuscular2500 [USP'U]/.5mL
Injection, solutionintramuscular5000 [USP'U]/mL
Solutionintramuscular5000 unit
Prices
Unit descriptionCostUnit
Myobloc 10000 unit/2ml Solution 2ml Vial1245.5USD vial
Myobloc 2500 unit/0.5 ml vial299.4USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
PatentsNot Available
Properties
StateLiquid
Experimental PropertiesNot Available
References
Synthesis ReferenceNot Available
General References
  1. Montecucco C, Molgo J: Botulinal neurotoxins: revival of an old killer. Curr Opin Pharmacol. 2005 Jun;5(3):274-9. Pubmed
  2. Brin MF, Lew MF, Adler CH, Comella CL, Factor SA, Jankovic J, O’Brien C, Murray JJ, Wallace JD, Willmer-Hulme A, Koller M: Safety and efficacy of NeuroBloc (botulinum toxin type B) in type A-resistant cervical dystonia. Neurology. 1999 Oct 22;53(7):1431-8. Pubmed
  3. Shukla HD, Sharma SK: Clostridium botulinum: a bug with beauty and weapon. Crit Rev Microbiol. 2005;31(1):11-8. Pubmed
  4. Eisenach JH, Atkinson JL, Fealey RD: Hyperhidrosis: evolving therapies for a well-established phenomenon. Mayo Clin Proc. 2005 May;80(5):657-66. Pubmed
  5. Schurch B, Corcos J: Botulinum toxin injections for paediatric incontinence. Curr Opin Urol. 2005 Jul;15(4):264-7. Pubmed
External Links
ATC CodesNot Available
AHFS CodesNot Available
PDB Entries
FDA labelDownload (1.18 MB)
MSDSNot Available
Interactions
Drug Interactions
Drug
AclidiniumAclidinium may increase the anticholinergic activities of Botulinum Toxin Type B.
AmikacinAmikacin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.
AmitriptylineAmitriptyline may increase the anticholinergic activities of Botulinum Toxin Type B.
AmoxapineAmoxapine may increase the anticholinergic activities of Botulinum Toxin Type B.
Atracurium besylateAtracurium besylate may increase the neuromuscular blocking activities of Botulinum Toxin Type B.
AtropineAtropine may increase the anticholinergic activities of Botulinum Toxin Type B.
AzelastineAzelastine may increase the anticholinergic activities of Botulinum Toxin Type B.
BenzatropineBenzatropine may increase the anticholinergic activities of Botulinum Toxin Type B.
Botulinum Toxin Type ABotulinum Toxin Type A may increase the adverse neuromuscular activities of Botulinum Toxin Type B.
BrompheniramineBrompheniramine may increase the anticholinergic activities of Botulinum Toxin Type B.
CarbinoxamineCarbinoxamine may increase the anticholinergic activities of Botulinum Toxin Type B.
CetirizineCetirizine may increase the anticholinergic activities of Botulinum Toxin Type B.
ChlorphenamineChlorphenamine may increase the anticholinergic activities of Botulinum Toxin Type B.
ChlorpromazineChlorpromazine may increase the anticholinergic activities of Botulinum Toxin Type B.
Cisatracurium besylateCisatracurium besylate may increase the neuromuscular blocking activities of Botulinum Toxin Type B.
ClemastineClemastine may increase the anticholinergic activities of Botulinum Toxin Type B.
ClomipramineClomipramine may increase the anticholinergic activities of Botulinum Toxin Type B.
ClozapineClozapine may increase the anticholinergic activities of Botulinum Toxin Type B.
CyclizineCyclizine may increase the anticholinergic activities of Botulinum Toxin Type B.
CyclobenzaprineCyclobenzaprine may increase the anticholinergic activities of Botulinum Toxin Type B.
CyclopentolateCyclopentolate may increase the anticholinergic activities of Botulinum Toxin Type B.
CyproheptadineCyproheptadine may increase the anticholinergic activities of Botulinum Toxin Type B.
DarifenacinDarifenacin may increase the anticholinergic activities of Botulinum Toxin Type B.
DesipramineDesipramine may increase the anticholinergic activities of Botulinum Toxin Type B.
DesloratadineDesloratadine may increase the anticholinergic activities of Botulinum Toxin Type B.
Dexchlorpheniramine maleateDexchlorpheniramine maleate may increase the anticholinergic activities of Botulinum Toxin Type B.
DicyclomineDicyclomine may increase the anticholinergic activities of Botulinum Toxin Type B.
DimenhydrinateDimenhydrinate may increase the anticholinergic activities of Botulinum Toxin Type B.
DiphenhydramineDiphenhydramine may increase the anticholinergic activities of Botulinum Toxin Type B.
DisopyramideDisopyramide may increase the anticholinergic activities of Botulinum Toxin Type B.
DoxepinDoxepin may increase the anticholinergic activities of Botulinum Toxin Type B.
DoxylamineDoxylamine may increase the anticholinergic activities of Botulinum Toxin Type B.
DroperidolDroperidol may increase the anticholinergic activities of Botulinum Toxin Type B.
FesoterodineFesoterodine may increase the anticholinergic activities of Botulinum Toxin Type B.
FexofenadineFexofenadine may increase the anticholinergic activities of Botulinum Toxin Type B.
FlavoxateFlavoxate may increase the anticholinergic activities of Botulinum Toxin Type B.
FlupentixolFlupentixol may increase the anticholinergic activities of Botulinum Toxin Type B.
FluphenazineFluphenazine may increase the anticholinergic activities of Botulinum Toxin Type B.
GentamicinGentamicin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.
GlycopyrrolateGlycopyrrolate may increase the anticholinergic activities of Botulinum Toxin Type B.
HaloperidolHaloperidol may increase the anticholinergic activities of Botulinum Toxin Type B.
HomatropineHomatropine may increase the anticholinergic activities of Botulinum Toxin Type B.
HydroxyzineHydroxyzine may increase the anticholinergic activities of Botulinum Toxin Type B.
HyoscyamineHyoscyamine may increase the anticholinergic activities of Botulinum Toxin Type B.
ImipramineImipramine may increase the anticholinergic activities of Botulinum Toxin Type B.
Ipratropium bromideIpratropium bromide may increase the anticholinergic activities of Botulinum Toxin Type B.
IsocarboxazidIsocarboxazid may increase the anticholinergic activities of Botulinum Toxin Type B.
KanamycinKanamycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.
LevocabastineLevocabastine may increase the anticholinergic activities of Botulinum Toxin Type B.
LevocetirizineLevocetirizine may increase the anticholinergic activities of Botulinum Toxin Type B.
LoratadineLoratadine may increase the anticholinergic activities of Botulinum Toxin Type B.
LoxapineLoxapine may increase the anticholinergic activities of Botulinum Toxin Type B.
MaprotilineMaprotiline may increase the anticholinergic activities of Botulinum Toxin Type B.
MeclizineMeclizine may increase the anticholinergic activities of Botulinum Toxin Type B.
MepenzolateMepenzolate may increase the anticholinergic activities of Botulinum Toxin Type B.
MethotrimeprazineMethotrimeprazine may increase the anticholinergic activities of Botulinum Toxin Type B.
MethscopolamineMethscopolamine may increase the anticholinergic activities of Botulinum Toxin Type B.
MoclobemideMoclobemide may increase the anticholinergic activities of Botulinum Toxin Type B.
NeomycinNeomycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.
NortriptylineNortriptyline may increase the anticholinergic activities of Botulinum Toxin Type B.
OlanzapineOlanzapine may increase the anticholinergic activities of Botulinum Toxin Type B.
OlopatadineOlopatadine may increase the anticholinergic activities of Botulinum Toxin Type B.
OrphenadrineOrphenadrine may increase the anticholinergic activities of Botulinum Toxin Type B.
OxybutyninOxybutynin may increase the anticholinergic activities of Botulinum Toxin Type B.
PancuroniumPancuronium may increase the neuromuscular blocking activities of Botulinum Toxin Type B.
PerphenazinePerphenazine may increase the anticholinergic activities of Botulinum Toxin Type B.
PhenelzinePhenelzine may increase the anticholinergic activities of Botulinum Toxin Type B.
PimozidePimozide may increase the anticholinergic activities of Botulinum Toxin Type B.
PizotifenPizotifen may increase the anticholinergic activities of Botulinum Toxin Type B.
ProchlorperazineProchlorperazine may increase the anticholinergic activities of Botulinum Toxin Type B.
ProcyclidineProcyclidine may increase the anticholinergic activities of Botulinum Toxin Type B.
PromazinePromazine may increase the anticholinergic activities of Botulinum Toxin Type B.
PromethazinePromethazine may increase the anticholinergic activities of Botulinum Toxin Type B.
PropanthelinePropantheline may increase the anticholinergic activities of Botulinum Toxin Type B.
ProtriptylineProtriptyline may increase the anticholinergic activities of Botulinum Toxin Type B.
QuetiapineQuetiapine may increase the anticholinergic activities of Botulinum Toxin Type B.
RisperidoneRisperidone may increase the anticholinergic activities of Botulinum Toxin Type B.
RocuroniumRocuronium may increase the neuromuscular blocking activities of Botulinum Toxin Type B.
ScopolamineScopolamine may increase the anticholinergic activities of Botulinum Toxin Type B.
Scopolamine butylbromideScopolamine butylbromide may increase the anticholinergic activities of Botulinum Toxin Type B.
SolifenacinSolifenacin may increase the anticholinergic activities of Botulinum Toxin Type B.
StreptomycinStreptomycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.
SuccinylcholineSuccinylcholine may increase the neuromuscular blocking activities of Botulinum Toxin Type B.
ThioridazineThioridazine may increase the anticholinergic activities of Botulinum Toxin Type B.
ThiothixeneThiothixene may increase the anticholinergic activities of Botulinum Toxin Type B.
TiotropiumTiotropium may increase the anticholinergic activities of Botulinum Toxin Type B.
TobramycinTobramycin may increase the neuromuscular blocking activities of Botulinum Toxin Type B.
TolterodineTolterodine may increase the anticholinergic activities of Botulinum Toxin Type B.
TranylcypromineTranylcypromine may increase the anticholinergic activities of Botulinum Toxin Type B.
TrifluoperazineTrifluoperazine may increase the anticholinergic activities of Botulinum Toxin Type B.
TrihexyphenidylTrihexyphenidyl may increase the anticholinergic activities of Botulinum Toxin Type B.
TrimethobenzamideTrimethobenzamide may increase the anticholinergic activities of Botulinum Toxin Type B.
TrimipramineTrimipramine may increase the anticholinergic activities of Botulinum Toxin Type B.
TriprolidineTriprolidine may increase the anticholinergic activities of Botulinum Toxin Type B.
TrospiumTrospium may increase the anticholinergic activities of Botulinum Toxin Type B.
UmeclidiniumUmeclidinium may increase the anticholinergic activities of Botulinum Toxin Type B.
VecuroniumVecuronium may increase the neuromuscular blocking activities of Botulinum Toxin Type B.
ZuclopenthixolZuclopenthixol may increase the anticholinergic activities of Botulinum Toxin Type B.
Food InteractionsNot Available

Targets

1. Vesicle-associated membrane protein 2

Kind: Protein

Organism: Human

Pharmacological action: yes

Actions: binder

Components

Name UniProt ID Details
Vesicle-associated membrane protein 2 P63027 Details

References:

  1. Liu W, Montana V, Chapman ER, Mohideen U, Parpura V: Botulinum toxin type B micromechanosensor. Proc Natl Acad Sci U S A. 2003 Nov 11;100(23):13621-5. Epub 2003 Oct 22. Pubmed
  2. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

2. Vesicle-associated membrane protein 1

Kind: Protein

Organism: Human

Pharmacological action: yes

Actions: binder

Components

Name UniProt ID Details
Vesicle-associated membrane protein 1 P23763 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

3. Synaptotagmin-2

Kind: Protein

Organism: Human

Pharmacological action: yes

Components

Name UniProt ID Details
Synaptotagmin-2 Q8N9I0 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed
  3. Poulain B, Lonchamp E, Jover E, Popoff MR, Molgo J: [Mechanisms of action of botulinum toxins and neurotoxins] Ann Dermatol Venereol. 2009 May;136 Suppl 4:S73-6. Pubmed

Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on September 22, 2015 14:17