You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameAbciximab
Accession NumberDB00054  (BTD00041, BIOD00041)
TypeBiotech
GroupsApproved
Description

Abciximab is a Fab fragment of the chimeric human-murine monoclonal antibody 7E3. Abciximab binds to the glycoprotein (GP) IIb/IIIa receptor of human platelets and inhibits platelet aggregation by preventing the binding of fibrinogen, von Willebrand factor, and other adhesive molecules. It also binds to vitronectin (αvβ3) receptor found on platelets and vessel wall endothelial and smooth muscle cells.

Protein structureDb00054
Related Articles
Protein chemical formulaC6462H9964N1690O2049S48
Protein average weight145651.1 Da
Sequences
>1TXV:H ReoPro-like antibody Heavy Chain 1
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKY
DPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>1TXV:L ReoPro-like antibody Light Chain 1
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPS
RFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>1TXV:H ReoPro-like antibody Heavy Chain 2
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKY
DPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>1TXV:L ReoPro-like antibody Light Chain 2
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPS
RFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Download FASTA Format
Synonyms
7E3
7E3 antibody
antiGPIIBIIIa
C7E3
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Reoproinjection, solution2 mg/mLintravenousEli Lilly and Company1993-12-16Not applicableUs
Reoprosolution2 mgintravenousJanssen Biotech Inc1996-10-30Not applicableCanada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNIIX85G7936GV
CAS number143653-53-6
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationAbciximab is indicated as an adjunct to percutaneous coronary intervention for the prevention of cardiac ischemic complications in patients undergoing percutaneous coronary intervention and in patients with unstable angina not responding to conventional medical therapy when percutaneous coronary intervention is planned within 24 hours. Abciximab is intended for use with aspirin and heparin and has been studied only in that setting.
PharmacodynamicsAbciximab inhibits platelet aggregation by preventing the binding of fibrinogen, von Willebrand factor, and other adhesive molecules to GPIIb/IIIa receptor sites on activated platelets. A single intravenous bolus dose from 0.15 mg/kg to 0.30 mg/kg produced rapid dose-dependent inhibition of platelet function. After two hours post-injection with a dose of 0.25 - 0.30 mg/kg, 80% of the GPIIb/IIIa receptors were blocked and platelet aggregation was prevented. GPIIb/IIIa is the major surface receptor involved in the final pathway of platelet aggregation. Bleeding time increases to over 30 minutes at the aforementioned doses. To compare, baseline values were five minutes.
Mechanism of actionAbciximab binds to the intact platelet GPIIb/IIIa receptor, which is a member of the integrin family of adhesion receptors and the major platelet surface receptor involved in platelet aggregation. This binding is thought to involve steric hindrance and/or conformational alterations which block access of large molecules to the receptor rather than direct interaction with the RGD (arginine-glycine-aspartic acid) binding site of GPIIb/IIIa. By binding to the vitronectin receptor (also known as the αvβ3 integrin), abciximab blocks effects mediated by this integrin which include cell adhesion. Furthermore, abciximab blocks Mac-1 receptor on monocytes and neutrophils thus inhibiting monocyte adhesion.
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to platelets, or by human antimurine antibody production. Excreted renally.

Route of eliminationNot Available
Half lifeFollowing intravenous bolus administration, free plasma concentrations of Abciximab decrease rapidly with an initial half-life of less than 10 minutes and a second phase half-life of about 30 minutes, probably related to rapid binding to the platelet GPIIb/IIIa receptors.
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
Pathways
PathwayCategorySMPDB ID
Abciximab Action PathwayDrug actionSMP00265
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug Reactions
Interacting Gene/EnzymeSNP RS IDAllele nameDefining changeAdverse ReactionReference(s)
Integrin beta-3
Gene symbol: ITGB3
UniProt: P05106
Not AvailableGPIIIa PlA2A2 AlleleAssociated with greater restenosis and risk for subacute coronary thrombosis in patients administered antiplatelet therapy.10732888
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionintravenous2 mg/mL
Solutionintravenous2 mg
Prices
Unit descriptionCostUnit
Reopro 2 mg/ml vial155.77USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1341357 No2002-05-072019-05-07Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.424Not Available
isoelectric point6.16Not Available
References
Synthesis ReferenceNot Available
General References
  1. Authors unspecified: Use of a monoclonal antibody directed against the platelet glycoprotein IIb/IIIa receptor in high-risk coronary angioplasty. The EPIC Investigation. N Engl J Med. 1994 Apr 7;330(14):956-61. [PubMed:8121459 ]
  2. Tcheng JE, Kandzari DE, Grines CL, Cox DA, Effron MB, Garcia E, Griffin JJ, Guagliumi G, Stuckey T, Turco M, Fahy M, Lansky AJ, Mehran R, Stone GW: Benefits and risks of abciximab use in primary angioplasty for acute myocardial infarction: the Controlled Abciximab and Device Investigation to Lower Late Angioplasty Complications (CADILLAC) trial. Circulation. 2003 Sep 16;108(11):1316-23. Epub 2003 Aug 25. [PubMed:12939213 ]
External Links
ATC CodesB01AC13
AHFS Codes
  • 92:00.00
PDB Entries
FDA labelDownload (220 KB)
MSDSDownload (19.7 KB)
Interactions
Drug Interactions
Drug
AcenocoumarolAbciximab may increase the anticoagulant activities of Acenocoumarol.
Acetylsalicylic acidThe risk or severity of adverse effects can be increased when Abciximab is combined with Acetylsalicylic acid.
AlteplaseAlteplase may increase the anticoagulant activities of Abciximab.
Aminosalicylic AcidAminosalicylic Acid may increase the anticoagulant activities of Abciximab.
AnagrelideAnagrelide may increase the anticoagulant activities of Abciximab.
AnistreplaseAbciximab may increase the anticoagulant activities of Anistreplase.
ApixabanThe risk or severity of adverse effects can be increased when Abciximab is combined with Apixaban.
ArgatrobanAbciximab may increase the anticoagulant activities of Argatroban.
BelimumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Belimumab.
Bismuth SubsalicylateBismuth Subsalicylate may increase the anticoagulant activities of Abciximab.
BivalirudinAbciximab may increase the anticoagulant activities of Bivalirudin.
CaffeineCaffeine may increase the anticoagulant activities of Abciximab.
CangrelorCangrelor may increase the anticoagulant activities of Abciximab.
CelecoxibCelecoxib may increase the anticoagulant activities of Abciximab.
CilostazolCilostazol may increase the anticoagulant activities of Abciximab.
CitalopramCitalopram may increase the anticoagulant activities of Abciximab.
Citric AcidAbciximab may increase the anticoagulant activities of Citric Acid.
ClopidogrelClopidogrel may increase the anticoagulant activities of Abciximab.
CollagenaseThe risk or severity of adverse effects can be increased when Abciximab is combined with Collagenase.
Collagenase clostridium histolyticumThe risk or severity of adverse effects can be increased when Abciximab is combined with Collagenase clostridium histolyticum.
Cyproterone acetateThe therapeutic efficacy of Abciximab can be decreased when used in combination with Cyproterone acetate.
Dabigatran etexilateAbciximab may increase the anticoagulant activities of Dabigatran etexilate.
DalteparinAbciximab may increase the anticoagulant activities of Dalteparin.
DanaparoidAbciximab may increase the anticoagulant activities of Danaparoid.
DasatinibDasatinib may increase the anticoagulant activities of Abciximab.
DeferasiroxThe risk or severity of adverse effects can be increased when Abciximab is combined with Deferasirox.
Deoxycholic AcidThe risk or severity of adverse effects can be increased when Abciximab is combined with Deoxycholic Acid.
DesirudinAbciximab may increase the anticoagulant activities of Desirudin.
DesogestrelDesogestrel may decrease the anticoagulant activities of Abciximab.
DesvenlafaxineDesvenlafaxine may increase the anticoagulant activities of Abciximab.
DextranDextran may increase the anticoagulant activities of Abciximab.
Dextran 40Dextran 40 may increase the anticoagulant activities of Abciximab.
DiclofenacDiclofenac may increase the anticoagulant activities of Abciximab.
DicoumarolAbciximab may increase the anticoagulant activities of Dicoumarol.
DienogestThe therapeutic efficacy of Abciximab can be decreased when used in combination with Dienogest.
DiflunisalDiflunisal may increase the anticoagulant activities of Abciximab.
DihydrocodeineDihydrocodeine may increase the anticoagulant activities of Abciximab.
DipyridamoleDipyridamole may increase the anticoagulant activities of Abciximab.
DrospirenoneDrospirenone may decrease the anticoagulant activities of Abciximab.
DuloxetineDuloxetine may increase the anticoagulant activities of Abciximab.
Edetic AcidAbciximab may increase the anticoagulant activities of Edetic Acid.
EdoxabanEdoxaban may increase the anticoagulant activities of Abciximab.
EnoxaparinAbciximab may increase the anticoagulant activities of Enoxaparin.
EpoprostenolThe risk or severity of adverse effects can be increased when Epoprostenol is combined with Abciximab.
EptifibatideEptifibatide may increase the anticoagulant activities of Abciximab.
EscitalopramEscitalopram may increase the anticoagulant activities of Abciximab.
EstradiolEstradiol may decrease the anticoagulant activities of Abciximab.
Estrone sulfateEstropipate may decrease the anticoagulant activities of Abciximab.
Ethinyl EstradiolEthinyl Estradiol may decrease the anticoagulant activities of Abciximab.
Ethyl biscoumacetateAbciximab may increase the anticoagulant activities of Ethyl biscoumacetate.
Ethynodiol diacetateEthynodiol may decrease the anticoagulant activities of Abciximab.
EtodolacEtodolac may increase the anticoagulant activities of Abciximab.
EtonogestrelThe therapeutic efficacy of Abciximab can be decreased when used in combination with Etonogestrel.
FenoprofenFenoprofen may increase the anticoagulant activities of Abciximab.
FloctafenineFloctafenine may increase the anticoagulant activities of Abciximab.
FluoxetineFluoxetine may increase the anticoagulant activities of Abciximab.
FlurbiprofenFlurbiprofen may increase the anticoagulant activities of Abciximab.
FluvoxamineFluvoxamine may increase the anticoagulant activities of Abciximab.
Fondaparinux sodiumAbciximab may increase the anticoagulant activities of Fondaparinux sodium.
GlucosamineGlucosamine may increase the antiplatelet activities of Abciximab.
HeparinAbciximab may increase the anticoagulant activities of Heparin.
Hydroxyprogesterone caproateThe therapeutic efficacy of Abciximab can be decreased when used in combination with Hydroxyprogesterone caproate.
Ibritumomab tiuxetanThe risk or severity of adverse effects can be increased when Abciximab is combined with Ibritumomab.
IbrutinibThe risk or severity of adverse effects can be increased when Ibrutinib is combined with Abciximab.
IbuprofenIbuprofen may increase the anticoagulant activities of Abciximab.
IcosapentIcosapent may increase the anticoagulant activities of Abciximab.
Icosapent ethylIcosapent ethyl may increase the anticoagulant activities of Abciximab.
IloprostThe risk or severity of adverse effects can be increased when Iloprost is combined with Abciximab.
IndomethacinIndomethacin may increase the anticoagulant activities of Abciximab.
KetoprofenKetoprofen may increase the anticoagulant activities of Abciximab.
KetorolacKetorolac may increase the anticoagulant activities of Abciximab.
LevomilnacipranLevomilnacipran may increase the anticoagulant activities of Abciximab.
LevonorgestrelThe therapeutic efficacy of Abciximab can be decreased when used in combination with Levonorgestrel.
LimaprostLimaprost may increase the antiplatelet activities of Abciximab.
Magnesium salicylateMagnesium salicylate may increase the anticoagulant activities of Abciximab.
Medroxyprogesterone acetateThe therapeutic efficacy of Abciximab can be decreased when used in combination with Medroxyprogesterone Acetate.
Mefenamic acidMefenamic acid may increase the anticoagulant activities of Abciximab.
Megestrol acetateThe therapeutic efficacy of Abciximab can be decreased when used in combination with Megestrol acetate.
MeloxicamMeloxicam may increase the anticoagulant activities of Abciximab.
MestranolMestranol may decrease the anticoagulant activities of Abciximab.
MilnacipranMilnacipran may increase the anticoagulant activities of Abciximab.
NabumetoneNabumetone may increase the anticoagulant activities of Abciximab.
NadroparinAbciximab may increase the anticoagulant activities of Nadroparin.
NaproxenNaproxen may increase the anticoagulant activities of Abciximab.
NintedanibThe risk or severity of adverse effects can be increased when Abciximab is combined with Nintedanib.
NorethisteroneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Norethindrone.
NorgestimateNorgestimate may decrease the anticoagulant activities of Abciximab.
ObinutuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Obinutuzumab.
Omega-3 fatty acidsOmega-3 fatty acids may increase the antiplatelet activities of Abciximab.
Omega-3-acid ethyl estersOmega-3-acid ethyl esters may increase the anticoagulant activities of Abciximab.
OxaprozinOxaprozin may increase the anticoagulant activities of Abciximab.
ParoxetineParoxetine may increase the anticoagulant activities of Abciximab.
Pentosan PolysulfateThe risk or severity of adverse effects can be increased when Pentosan Polysulfate is combined with Abciximab.
PentoxifyllinePentoxifylline may increase the antiplatelet activities of Abciximab.
PhenindioneAbciximab may increase the anticoagulant activities of Phenindione.
PhenprocoumonAbciximab may increase the anticoagulant activities of Phenprocoumon.
PiroxicamPiroxicam may increase the anticoagulant activities of Abciximab.
PrasugrelPrasugrel may increase the anticoagulant activities of Abciximab.
ProgesteroneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Progesterone.
ReteplaseReteplase may increase the anticoagulant activities of Abciximab.
RidogrelAbciximab may increase the anticoagulant activities of Ridogrel.
RivaroxabanAbciximab may increase the anticoagulant activities of Rivaroxaban.
SalsalateSalsalate may increase the anticoagulant activities of Abciximab.
SertralineSertraline may increase the anticoagulant activities of Abciximab.
StreptokinaseAbciximab may increase the anticoagulant activities of Streptokinase.
SulindacSulindac may increase the anticoagulant activities of Abciximab.
SulodexideAbciximab may increase the anticoagulant activities of Sulodexide.
TenecteplaseTenecteplase may increase the anticoagulant activities of Abciximab.
Tiaprofenic acidTiaprofenic acid may increase the anticoagulant activities of Abciximab.
TicagrelorTicagrelor may increase the anticoagulant activities of Abciximab.
TiclopidineTiclopidine may increase the anticoagulant activities of Abciximab.
TinzaparinAbciximab may increase the anticoagulant activities of Tinzaparin.
TipranavirTipranavir may increase the antiplatelet activities of Abciximab.
TirofibanTirofiban may increase the anticoagulant activities of Abciximab.
TolmetinTolmetin may increase the anticoagulant activities of Abciximab.
TositumomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tositumomab.
TreprostinilAbciximab may increase the anticoagulant activities of Treprostinil.
UrokinaseAbciximab may increase the anticoagulant activities of Urokinase.
VenlafaxineVenlafaxine may increase the anticoagulant activities of Abciximab.
VilazodoneVilazodone may increase the anticoagulant activities of Abciximab.
Vitamin EVitamin E may increase the antiplatelet activities of Abciximab.
VorapaxarThe risk or severity of adverse effects can be increased when Vorapaxar is combined with Abciximab.
VortioxetineVortioxetine may increase the anticoagulant activities of Abciximab.
WarfarinAbciximab may increase the anticoagulant activities of Warfarin.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antagonist
General Function:
Virus receptor activity
Specific Function:
Integrin alpha-V/beta-3 (ITGAV:ITGB3) is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin alpha-IIb/beta-3 (ITGA2B:ITGB3) is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. Integrins alpha-IIb/beta-3 and alpha-V/bet...
Gene Name:
ITGB3
Uniprot ID:
P05106
Molecular Weight:
87056.975 Da
References
  1. Amoroso G, van Boven AJ, van Veldhuisen DJ, Tio RA, Balje-Volkers CP, Petronio AS, van Oeveren W: Eptifibatide and abciximab exhibit equivalent antiplatelet efficacy in an experimental model of stenting in both healthy volunteers and patients with coronary artery disease. J Cardiovasc Pharmacol. 2001 Oct;38(4):633-41. [PubMed:11588534 ]
  2. Weber AA, Meila D, Jacobs C, Weber S, Kelm M, Strauer BE, Zotz RB, Scharf RE, Schror K: Low incidence of paradoxical platelet activation by glycoprotein IIb/IIIa inhibitors. Thromb Res. 2002 Apr 1;106(1):25-9. [PubMed:12165285 ]
  3. Hall PR, Malone L, Sillerud LO, Ye C, Hjelle BL, Larson RS: Characterization and NMR solution structure of a novel cyclic pentapeptide inhibitor of pathogenic hantaviruses. Chem Biol Drug Des. 2007 Mar;69(3):180-90. [PubMed:17441904 ]
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  5. Mazzaferri EL Jr, Young JJ: Abciximab: a review and update for clinicians. Expert Rev Cardiovasc Ther. 2008 Jun;6(5):609-18. doi: 10.1586/14779072.6.5.609. [PubMed:18510478 ]
  6. Ibbotson T, McGavin JK, Goa KL: Abciximab: an updated review of its therapeutic use in patients with ischaemic heart disease undergoing percutaneous coronary revascularisation. Drugs. 2003;63(11):1121-63. [PubMed:12749745 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antagonist
General Function:
Metal ion binding
Specific Function:
Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. ...
Gene Name:
ITGA2B
Uniprot ID:
P08514
Molecular Weight:
113375.96 Da
References
  1. Gibbs NM: Point-of-care assessment of antiplatelet agents in the perioperative period: a review. Anaesth Intensive Care. 2009 May;37(3):354-69. [PubMed:19499855 ]
  2. Mazzaferri EL Jr, Young JJ: Abciximab: a review and update for clinicians. Expert Rev Cardiovasc Ther. 2008 Jun;6(5):609-18. doi: 10.1586/14779072.6.5.609. [PubMed:18510478 ]
  3. Ibbotson T, McGavin JK, Goa KL: Abciximab: an updated review of its therapeutic use in patients with ischaemic heart disease undergoing percutaneous coronary revascularisation. Drugs. 2003;63(11):1121-63. [PubMed:12749745 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4.
Gene Name:
C1S
Uniprot ID:
P09871
Molecular Weight:
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Scavenger receptor activity
Specific Function:
Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecule. Inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway.Somatomedin-B is a growth hormone-dependent serum factor ...
Gene Name:
VTN
Uniprot ID:
P04004
Molecular Weight:
54305.135 Da
References
  1. Romagnoli E, Burzotta F, Trani C, Biondi-Zoccai GG, Giannico F, Crea F: Rationale for intracoronary administration of abciximab. J Thromb Thrombolysis. 2007 Feb;23(1):57-63. [PubMed:17160551 ]
  2. Ibbotson T, McGavin JK, Goa KL: Abciximab: an updated review of its therapeutic use in patients with ischaemic heart disease undergoing percutaneous coronary revascularisation. Drugs. 2003;63(11):1121-63. [PubMed:12749745 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on March 14, 2016 09:58